Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR361 IGR362 IGR360 IGR363 CPn0456 CPn0457 pmpA,pmpI, - CPn0452 pmpG, - CPn0453 pmpH, - CPn0454 CPn0456 CPn0457 pmpA,pmpI, - CPn0452 pmpG, - CPn0453 pmpH, - CPn0454 CPn0456 CPn0457 CPn0455 CPn0455 pmpA,pmpI, - CPn0452 pmpG, - CPn0453 pmpH, - CPn0454
* Calculated from Protein Sequence

Gene ID: CPn0454

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpH  

Definition:
outer membrane protein H

Gene Start:
516182

Gene Stop:
519118

Gene Length:
2937

Molecular Weight*:
103651

pI*:
7.30

Net Charge*:
1.93

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0454 is similar to CT872, CT871, CT869, CT412, CT874, CT870, CT413, and CT812, all outer membrane proteins.
Residues 1-978 are 35% similar to CT872.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0454 is similar to sixteen other outer memebrane preteins, namely, CPn0467, CPn0446, CPn0444, CPn0466, CPn0453, CPn0471, CPn0445, CPn0539, CPn0447, CPn0451, CPn0005, CPn0013, CPn0540, CPn0963, CPn0470, CPn0452. No simiarities to M. genitalium, T. pallidum or U. urealyticum sequences.

Pfam Summary:  Pfam Search
Residues 1 to 461 (E-value = 2e-07) place CPn0454 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24
non-globular  
25  
308
non-globular  
420  
561

PDB Hit:


Gene Protein Sequence:
MPLSFKSSSFCLLACLCSASCAFAETRLGGNFVPPITNQGEEILLTSDFV
CSNFLGASFSSSFINSSSNLSLLGKGLSLTFTSCQAPTNSNYALLSAAET
LTFKNFSSINFTGNQSTGLGGLIYGKDIVFQSIKDLIFTTNRVAYSPASV
TTSATPAITTVTTGASALQPTDSLTVENISQSIKFFGNLANFGSAISSSP
TAVVKFINNTATMSFSHNFTSSGGGVIYGGSSLLFENNSGCIIFTANSCV
NSLKGVTPSSGTYALGSGGAICIPTGTFELKNNQGKCTFSYNGTPNDAGA
IYAETCNIVGNQGALLLDSNTAARNGGAICAKVLNIQGRGPIEFSRNRAE
KGGAIFIGPSVGDPAKQTSTLTILASEGDIAFQGNMLNTKPGIRNAITVE
AGGEIVSLSAQGGSRLVFYDPITHSLPTTSPSNKDITINANGASGSVVFT
SKGLSSTELLLPANTTTILLGTVKIASGELKITDNAVVNVLGFATQGSGQ
LTLGSGGTLGLATPTGAPAAVDFTIGKLAFDPFSFLKRDFVSASVNAGTK
NVTLTGALVLDEHDVTDLYDMVSLQSPVAIPIAVFKGATVTKTGFPDGEI
ATPSHYGYQGKWSYTWSRPLLIPAPDGGFPGGPSPSANTLYAVWNSDTLV
RSTYILDPERYGEIVSNSLWISFLGNQAFSDILQDVLLIDHPGLSITAKA
LGAYVEHTPRQGHEGFSGRYGGYQAALSMNYTDHTTLGLSFGQLYGKTNA
NPYDSRCSEQMYLLSFFGQFPIVTQKSEALISWKAAYGYSKNHLNTTYLR
PDKAPKSQGQWHNNSYYVLISAEHPFLNWCLLTRPLAQAWDLSGFISAEF
LGGWQSKFTETGDLQRSFSRGKGYNVSLPIGCSSQWFTPFKKAPSTLTIK
LAYKPDIYRVNPHNIVTVVSNQESTSISGANLRRHGLFVQIHDVVDLTED
TQAFLNYTFDGKNGFTNHRVSTGLKSTF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTCTTTCTTTCAAATCTTCATCTTTTTGTCTACTTGCCTGTTTATG
TAGTGCAAGTTGCGCGTTTGCTGAGACTAGACTCGGAGGGAACTTTGTTC
CTCCAATTACGAATCAGGGTGAAGAGATCTTACTCACTTCAGATTTTGTT
TGTTCAAACTTCTTGGGGGCGAGTTTTTCAAGTTCCTTTATCAATAGTTC
CAGCAATCTCTCCTTATTAGGGAAGGGCCTTTCCTTAACGTTTACCTCTT
GTCAAGCTCCTACAAATAGTAACTATGCGCTACTTTCTGCCGCAGAGACT
CTGACCTTCAAGAATTTTTCTTCTATAAACTTTACAGGGAACCAATCGAC
AGGACTTGGCGGCCTCATCTACGGAAAAGATATTGTTTTCCAATCTATCA
AAGATTTGATCTTCACTACGAACCGTGTTGCCTATTCTCCAGCATCTGTA
ACTACGTCGGCAACTCCCGCAATCACTACAGTAACTACAGGAGCCTCTGC
TCTCCAACCTACAGACTCACTCACTGTCGAAAACATATCCCAATCGATCA
AGTTTTTTGGGAACCTTGCCAACTTCGGCTCTGCAATTAGCAGTTCTCCC
ACGGCAGTCGTTAAATTCATCAATAACACCGCTACCATGAGCTTCTCCCA
TAACTTTACTTCGTCAGGAGGCGGCGTGATTTATGGAGGAAGCTCTCTCC
TTTTTGAAAACAATTCTGGATGCATCATCTTCACCGCCAACTCCTGTGTG
AACAGCTTAAAAGGCGTCACCCCTTCATCAGGAACCTATGCTTTAGGAAG
TGGCGGAGCCATCTGCATCCCTACGGGAACTTTCGAATTAAAAAACAATC
AGGGGAAGTGCACCTTCTCTTATAATGGTACACCAAATGATGCGGGTGCG
ATCTACGCCGAAACCTGCAACATCGTAGGGAACCAGGGTGCCTTGCTCCT
AGATAGCAACACTGCAGCGAGAAATGGCGGAGCCATCTGTGCTAAAGTGC
TCAATATTCAAGGACGCGGTCCTATTGAATTCTCTAGAAACCGCGCGGAG
AAGGGTGGAGCTATTTTCATAGGCCCCTCTGTTGGAGACCCTGCGAAGCA
AACATCGACACTTACGATTTTGGCTTCCGAAGGTGATATTGCGTTCCAAG
GAAACATGCTCAATACAAAACCTGGAATCCGCAATGCCATCACTGTAGAA
GCAGGGGGAGAGATTGTGTCTCTATCTGCACAAGGAGGCTCACGTCTTGT
ATTTTATGATCCCATTACACATAGCCTCCCAACCACAAGTCCGTCTAATA
AAGACATTACAATCAACGCTAATGGCGCTTCAGGATCTGTAGTCTTTACA
AGTAAGGGACTCTCCTCTACAGAACTCCTGTTGCCTGCCAACACGACAAC
TATACTTCTAGGAACAGTCAAGATCGCTAGTGGAGAACTGAAGATTACTG
ACAATGCGGTTGTCAATGTTCTTGGCTTCGCTACTCAGGGCTCAGGTCAG
CTTACCCTGGGCTCTGGAGGAACCTTAGGGCTGGCAACACCCACGGGAGC
ACCTGCCGCTGTAGACTTTACGATTGGAAAGTTAGCATTCGATCCTTTTT
CCTTCCTAAAAAGAGATTTTGTTTCAGCATCAGTAAATGCAGGCACAAAA
AACGTCACTTTAACAGGAGCTCTGGTTCTTGATGAACATGACGTTACAGA
TCTTTATGATATGGTGTCATTACAATCTCCAGTAGCAATTCCTATCGCTG
TTTTCAAAGGAGCAACCGTTACTAAGACAGGATTTCCTGATGGGGAGATT
GCGACTCCAAGCCACTACGGCTACCAAGGAAAGTGGTCCTACACATGGTC
CCGTCCCCTGTTAATTCCAGCTCCTGATGGAGGATTTCCTGGAGGTCCCT
CTCCTAGCGCAAATACTCTCTATGCTGTATGGAATTCAGACACTCTCGTG
CGTTCTACCTATATCTTAGATCCCGAGCGTTACGGAGAAATTGTCAGCAA
CAGCTTATGGATTTCCTTCTTAGGAAATCAGGCATTCTCTGATATTCTCC
AAGATGTTCTTTTGATAGATCATCCCGGGTTGTCCATAACCGCGAAAGCT
TTAGGAGCCTATGTCGAACACACACCAAGACAAGGACATGAGGGCTTTTC
AGGTCGCTATGGAGGCTACCAAGCTGCGCTATCTATGAACTACACGGACC
ACACTACGTTAGGACTTTCTTTCGGGCAGCTTTATGGAAAAACTAACGCC
AACCCCTACGATTCACGTTGCTCAGAACAAATGTATTTACTCTCGTTCTT
TGGTCAATTCCCTATCGTGACTCAAAAGAGCGAGGCCTTAATTTCCTGGA
AAGCAGCTTATGGTTATTCCAAAAATCACCTAAATACCACCTACCTCAGA
CCTGACAAAGCTCCAAAATCTCAAGGGCAATGGCATAACAATAGTTACTA
TGTTCTTATTTCTGCAGAACATCCTTTCCTAAACTGGTGTCTTCTTACAA
GACCTCTGGCTCAAGCTTGGGATCTTTCAGGTTTTATTTCCGCAGAATTC
CTAGGTGGTTGGCAAAGTAAGTTCACAGAAACTGGAGATCTGCAACGTAG
CTTTAGTAGAGGTAAAGGGTACAATGTTTCCCTACCGATAGGATGTTCTT
CTCAATGGTTCACACCATTTAAGAAGGCTCCTTCTACACTGACCATCAAA
CTTGCCTACAAGCCTGATATCTATCGTGTCAACCCTCACAATATTGTGAC
TGTCGTCTCAAACCAAGAGAGCACTTCGATCTCAGGAGCAAATCTACGCC
GCCACGGTTTGTTTGTACAAATCCATGATGTAGTAGATCTCACCGAGGAC
ACTCAGGCCTTTCTAAACTATACCTTTGACGGGAAAAATGGATTTACAAA
CCACCGAGTGTCTACAGGACTAAAATCCACATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy