Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR361 IGR359 IGR362 IGR360 CPn0455 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453 pmpH, - CPn0454 CPn0455 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453 pmpH, - CPn0454 CPn0455 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453 pmpH, - CPn0454
* Calculated from Protein Sequence

Gene ID: CPn0453

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpG  

Definition:
outer membrane protein

Gene Start:
513234

Gene Stop:
516155

Gene Length:
2922

Molecular Weight*:
102758

pI*:
7.30

Net Charge*:
2.75

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0453 is similar to CT871, CT874, CT872, CT412, CT869, CT870, CT413, CT812 and CT414. They are all predicted outer membrane proteins. No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0453 is paralogously related to CPn0446, CPn0447, CPn0451, CPn0445, CPn0444, CPn0005, CPn0013, CPn0466, CPn0471, CPn0454, CPn0467, CPn0539, CPn0963, CPn0540, CPn0452, CPn0470. They are all predicted outer membrane proteins.

Pfam Summary:  Pfam Search
Residues 2 to 429 (E-value = 8.2e-181) place CPn0453 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24
non-globular  
155  
347
non-globular  
402  
584
non-globular  
738  
840

PDB Hit:


Gene Protein Sequence:
MKTSIRKFLISTTLAPCFASTAFTVEVIMPSENFDGSSGKIFPYTTLSDP
RGTLCIFSGDLYIANLDNAISRTSSSCFSNRAGALQILGKGGVFSFLNIR
SSADGAAISSVITQNPELCPLSFSGFSQMIFDNCESLTSDTSASNVIPHA
SAIYATTPMLFTNNDSILFQYNRSAGFGAAIRGTSITIENTKKSLLFNGN
GSISNGGALTGSAAINLINNSAPVIFSTNATGIYGGAIYLTGGSMLTSGN
LSGVLFVNNSSRSGGAIYANGNVTFSNNSDLTFQNNTASPQNSLPAPTPP
PTPPAVTPLLGYGGAIFCTPPATPPPTGVSLTISGENSVTFLENIASEQG
GALYGKKISIDSNKSTIFLGNTAGKGGAIAIPESGELSLSANQGDILFNK
NLSITSGTPTRNSIHFGKDAKFATLGATQGYTLYFYDPITSDDLSAASAA
ATVVVNPKASADGAYSGTIVFSGETLTATEAATPANATSTLNQKLELEGG
TLALRNGATLNVHNFTQDEKSVVIMDAGTTLATTNGANNTDGAITLNKLV
INLDSLDGTKAAVVNVQSTNGALTISGTLGLVKNSQDCCDNHGMFNKDLQ
QVPILELKATSNTVTTTDFSLGTNGYQQSPYGYQGTWEFTIDTTTHTVTG
NWKKTGYLPHPERLAPLIPNSLWANVIDLRAVSQASAADGEDVPGKQLSI
TGITNFFHANHTGDARSYRHMGGGYLINTYTRITPDAALSLGFGQLFTKS
KDYLVGHGHSNVYFATVYSNITKSLFGSSRFFSGGTSRVTYSRSNEKVKT
SYTKLPKGRCSWSNNCWLGELEGNLPITLSSRILNLKQIIPFVKAEVAYA
THGGIQENTPEGRIFGHGHLLNVAVPVGVRFGKNSHNRPDFYTIIVAYAP
DVYRHNPDCDTTLPINGATWTSIGNNLTRSTLLVQASSHTSVNDVLEIFG
HCGCDIRRTSRQYTLDIGSKLRF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACGTCTATTCGTAAGTTCTTAATTTCTACCACACTGGCGCCATG
TTTTGCTTCAACAGCGTTTACTGTAGAAGTTATCATGCCTTCCGAGAACT
TTGATGGATCGAGTGGGAAGATTTTTCCTTACACAACACTTTCTGATCCT
AGAGGGACACTCTGTATTTTTTCAGGGGATCTCTACATTGCGAATCTTGA
TAATGCCATATCCAGAACCTCTTCCAGTTGCTTTAGCAATAGGGCGGGAG
CACTACAAATCTTAGGAAAAGGTGGGGTTTTCTCCTTCTTAAATATCCGT
TCTTCAGCTGACGGAGCCGCGATTAGTAGTGTAATCACCCAAAATCCTGA
ACTATGTCCCTTGAGTTTTTCAGGATTTAGTCAGATGATCTTCGATAACT
GTGAATCTTTGACTTCAGATACCTCAGCGAGTAATGTCATACCTCACGCA
TCGGCGATTTACGCTACAACGCCCATGCTCTTTACAAACAATGACTCCAT
ACTATTCCAATACAACCGTTCTGCAGGATTTGGAGCTGCCATTCGAGGCA
CAAGCATCACAATAGAAAATACGAAAAAGAGCCTTCTCTTTAATGGTAAT
GGATCCATCTCTAATGGAGGGGCCCTCACGGGATCTGCAGCGATCAACCT
CATCAACAATAGCGCTCCTGTGATTTTCTCAACGAATGCTACAGGGATCT
ATGGTGGGGCTATTTACCTTACCGGAGGATCTATGCTCACCTCTGGGAAC
CTCTCAGGAGTCTTGTTCGTTAATAATAGCTCGCGCTCAGGAGGCGCTAT
CTATGCTAACGGAAATGTCACATTTTCTAATAACAGCGACCTGACTTTCC
AAAACAATACAGCATCTCCACAAAACTCCTTACCTGCACCTACACCTCCA
CCTACACCACCAGCAGTCACTCCTTTGTTAGGATATGGAGGCGCCATCTT
CTGTACTCCTCCAGCTACCCCCCCACCAACAGGTGTTAGCCTGACTATAT
CTGGAGAAAACAGCGTTACATTCCTAGAAAACATTGCCTCCGAACAAGGA
GGAGCCCTCTATGGCAAAAAGATCTCTATAGATTCTAATAAATCTACAAT
ATTTCTTGGAAATACAGCTGGAAAAGGAGGCGCTATTGCTATTCCCGAAT
CTGGGGAGCTCTCTCTATCCGCAAATCAAGGTGATATCCTCTTTAACAAG
AACCTCAGCATCACTAGTGGGACACCTACTCGCAATAGTATTCACTTCGG
AAAAGATGCCAAGTTTGCCACTCTAGGAGCTACGCAAGGCTATACCCTAT
ACTTCTATGATCCGATTACATCTGATGATTTATCTGCTGCATCCGCAGCC
GCTACTGTGGTCGTCAATCCCAAAGCCAGTGCAGATGGTGCGTATTCAGG
GACTATTGTCTTTTCAGGAGAAACCCTCACTGCTACCGAAGCAGCAACCC
CTGCAAATGCTACATCTACATTAAACCAAAAGCTAGAACTTGAAGGCGGT
ACTCTCGCTTTAAGAAACGGTGCTACCTTAAATGTTCATAACTTCACGCA
AGATGAAAAGTCCGTCGTCATCATGGATGCAGGGACCACATTAGCAACTA
CAAATGGAGCTAATAATACTGACGGTGCTATCACCTTAAACAAGCTTGTA
ATCAATCTGGATTCTTTGGATGGCACTAAAGCGGCTGTCGTTAATGTGCA
GAGTACCAATGGAGCTCTCACTATATCCGGAACTTTAGGACTTGTGAAAA
ACTCTCAAGATTGCTGTGACAACCACGGGATGTTTAATAAAGATTTACAG
CAAGTTCCGATTTTAGAACTCAAAGCGACTTCAAATACTGTAACCACTAC
GGACTTCAGTCTCGGCACAAACGGCTATCAGCAATCTCCCTATGGGTATC
AAGGAACTTGGGAGTTTACCATAGACACGACAACCCATACGGTCACAGGA
AATTGGAAAAAAACCGGTTATCTTCCTCATCCGGAGCGTCTTGCTCCCCT
CATTCCTAATAGCCTATGGGCAAACGTCATAGATTTACGAGCTGTAAGTC
AAGCGTCAGCAGCTGATGGCGAAGATGTCCCTGGGAAGCAACTGAGCATC
ACAGGAATTACAAATTTCTTCCATGCGAATCATACCGGTGATGCACGCAG
CTACCGCCATATGGGTGGAGGCTACCTCATCAATACCTACACACGCATCA
CTCCAGATGCTGCGTTAAGTCTAGGTTTTGGACAGCTGTTTACAAAATCT
AAGGATTACCTCGTAGGTCACGGTCATTCTAACGTTTATTTCGCTACAGT
ATACTCTAACATCACCAAGTCTCTGTTTGGATCATCGAGATTCTTCTCAG
GAGGCACTTCTCGAGTTACCTATAGCCGTAGCAATGAGAAAGTAAAGACT
TCATATACAAAATTGCCTAAAGGGCGCTGCTCTTGGAGTAACAATTGCTG
GTTAGGAGAACTCGAAGGGAACCTTCCCATCACTCTCTCTTCTCGCATCT
TAAACCTCAAGCAGATCATTCCCTTTGTAAAAGCTGAAGTTGCTTACGCG
ACTCATGGGGGCATCCAAGAAAATACCCCCGAGGGGAGGATTTTTGGACA
CGGTCATCTACTCAACGTTGCAGTTCCCGTAGGCGTCCGCTTTGGTAAAA
ATTCTCATAATCGACCAGATTTTTACACTATAATCGTAGCCTATGCTCCT
GATGTCTATCGTCACAATCCTGATTGCGATACGACATTACCTATTAATGG
AGCTACGTGGACCTCTATAGGGAATAATCTAACCAGAAGTACTTTGCTAG
TACAAGCATCCAGCCATACTTCAGTAAATGATGTTCTAGAGATCTTCGGG
CACTGTGGATGTGATATTCGCAGAACCTCCCGTCAATATACTCTAGATAT
AGGAAGCAAATTACGATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy