Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR361 IGR358.1 IGR359 IGR360 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453 pmpH, - CPn0454 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453 pmpH, - CPn0454 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453 pmpH, - CPn0454
* Calculated from Protein Sequence

Gene ID: CPn0452

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpA  pmpI  

Definition:
outer membrane protein A/I

Gene Start:
511319

Gene Stop:
512863

Gene Length:
1545

Molecular Weight*:
56085

pI*:
4.90

Net Charge*:
-18.22

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0452 is similar to CT874, CT412, CT872, CT871, CT812, CT869, CT413, CT870, and CT414, all predicted outer membrane proteins. CT874 is a predicted pmpI outer membrane protein I. Residues 69-484 are 25% similar to CT874. No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0452 is paralogously related to CPn0013, CPn0447, CPn0446, CPn0445, CPn0451, CPn0453, CPn0005, CPn0444, CPn0539, CPn0454, CPn0963, CPn0467, CPn0466, CPn0540, CPn0471. They are all predicted polymorphic outer membrane proteins.

Pfam Summary:  Pfam Search
Residues 1 to 422 (E-value = 1.1e-189) place CPn0452 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21
non-globular  
317  
385

PDB Hit:


Gene Protein Sequence:
MTILRNFLTCSALFLALPAAAQVVYLHESDGYNGAINNKSLEPKITCYPE
GTSYIFLDDVRISNVKHDQEDAGVFINRSGNLFFMGNRCNFTFHNLMTEG
FGAAISNRVGDTTLTLSNFSYLAFTSAPLLPQGQGAIYSLGSVMIENSEE
VTFCGNYSSWSGAAIYTPYLLGSKASRPSVNLSGNRYLVFRDNVSQGYGG
AISTHNLTLTTRGPSCFENNHAYHDVNSNGGAIAIAPGGSISISVKSGDL
IFKGNTASQDGNTIHNSIHLQSGAQFKNLRAVSESGVYFYDPISHSESHK
ITDLVINAPEGKETYEGTISFSGLCLDDHEVCAENLTSTILQDVTLAGGT
LSLSDGVTLQLHSFKQEASSTLTMSPGTTLLCSGDARVQNLHILIEDTDN
FVPVRIRAEDKDALVSLEKLKVAFEAYWSVYDFPQFKEAFTIPLLELLGP
SFDSLLLGETTLERTQVTTENDAVRGFWSLSWEEYPPSLDKDRRITPTKK
TVFLTWNPEITSTP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCATACTTCGAAATTTTCTTACCTGCTCGGCTTTATTCCTCGCTCT
CCCTGCAGCAGCACAAGTTGTATATCTTCATGAAAGTGATGGTTATAACG
GTGCTATCAATAATAAAAGCTTAGAACCTAAAATTACCTGTTATCCAGAA
GGAACTTCTTACATCTTTCTAGATGACGTGAGGATTTCCAACGTTAAGCA
TGATCAAGAAGATGCTGGGGTTTTTATAAATCGATCTGGGAATCTTTTTT
TCATGGGCAACCGTTGCAACTTCACTTTTCACAACCTTATGACCGAGGGT
TTTGGCGCTGCCATTTCGAACCGCGTTGGAGACACCACTCTCACTCTCTC
TAATTTTTCTTACTTAGCGTTCACCTCAGCACCTCTACTACCTCAAGGAC
AAGGAGCGATTTATAGTCTTGGTTCCGTGATGATCGAAAATAGTGAGGAA
GTGACTTTCTGTGGGAACTACTCTTCGTGGAGTGGAGCTGCGATTTATAC
TCCCTACCTTTTAGGTTCTAAGGCGAGTCGTCCTTCAGTAAATCTCAGCG
GGAACCGCTACCTGGTGTTTAGAGACAATGTGAGCCAAGGTTATGGCGGC
GCCATATCTACCCACAATCTCACACTCACGACTCGAGGACCTTCGTGTTT
TGAAAATAATCATGCTTATCATGACGTGAATAGTAATGGAGGAGCCATTG
CCATTGCTCCTGGAGGATCGATCTCTATATCCGTGAAAAGCGGAGATCTC
ATCTTCAAAGGAAATACAGCATCACAAGACGGAAATACAATACACAACTC
CATCCATCTGCAATCTGGAGCACAGTTTAAGAACCTACGTGCTGTTTCAG
AATCCGGAGTTTATTTCTATGATCCTATAAGCCATAGCGAGTCGCATAAA
ATTACAGATCTTGTAATCAATGCTCCTGAAGGAAAGGAAACTTATGAAGG
AACAATTAGCTTCTCAGGACTATGCCTGGATGATCATGAAGTTTGTGCGG
AAAATCTTACTTCCACAATCCTACAAGATGTCACATTAGCAGGAGGAACT
CTCTCTCTATCGGATGGGGTTACCTTGCAACTGCATTCTTTTAAGCAGGA
AGCAAGCTCTACGCTTACTATGTCTCCAGGAACCACTCTGCTCTGCTCAG
GAGATGCTCGGGTTCAGAATCTGCACATCCTGATTGAAGATACCGACAAC
TTTGTTCCTGTAAGGATTCGCGCCGAGGACAAGGATGCTCTTGTCTCATT
AGAAAAACTTAAAGTTGCCTTTGAGGCTTATTGGTCCGTCTATGACTTTC
CTCAATTTAAGGAAGCCTTTACGATTCCTCTTCTTGAACTTCTAGGGCCT
TCTTTTGACAGTCTTCTCCTAGGGGAGACCACTTTGGAGAGAACCCAAGT
CACAACAGAGAATGACGCCGTTCGAGGTTTCTGGTCCCTAAGCTGGGAAG
AGTACCCCCCTTCTCTGGATAAAGACAGAAGGATCACACCAACTAAGAAA
ACTGTTTTCCTCACTTGGAATCCTGAGATCACTTCTACGCCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy