Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR358.1 IGR359 IGR360 IGR358 CPn0448 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453 CPn0448 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453 CPn0448 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0453
* Calculated from Protein Sequence

Gene ID: CPn0451

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpG  

Definition:
outer membrane protein G

Gene Start:
508275

Gene Stop:
511061

Gene Length:
2787

Molecular Weight*:
98900

pI*:
6.40

Net Charge*:
-6.75

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0451 is similar to CT871, CT874, CT869, CT412, CT872, CT413, CT812, CT870, and CT414, all outer membrane proteins. Residues 1-928 are 28% similar to CT871. Residues 133-928 are 28% similar to CT871, a predicted pmpG outer membrane protein G.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0451 is paralogously related to CPn0447, CPN0446, CPn0445, CPn0005, CPn0013, CPn0453, CPn0444, CPn0539, CPn0467, CPn0466, CPn0454, CPn0471, CPn0540, CPn0452, CPn0963, CPn0470. They are all predicted outer membrane proteins.

Pfam Summary:  Pfam Search
Residues 2 to 419 (E-value = 5.3e-211) place CPn0451 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24
non-globular  
63  
516

PDB Hit:


Gene Protein Sequence:
MKTSIPWVLVSSVLAFSCHLQSLANEELLSPDDSFNGNIDSGTFTPKTSA
TTYSLTGDVFFYEPGKGTPLSDSCFKQTTDNLTFLGNGHSLTFGFIDAGT
HAGAAASTTANKNLTFSGFSLLSFDSSPSTTVTTGQGTLSSAGGVNLENI
RKLVVAGNFSTADGGAIKGASFLLTGTSGDALFSNNSSSTKGGAIATTAG
ARIANNTGYVRFLSNIASTSGGAIDDEGTSILSNNKFLYFEGNAAKTTGG
AICNTKASGSPELIISNNKTLIFASNVAETSGGAIHAKKLALSSGGFTEF
LRNNVSSATPKGGAISIDASGELSLSAETGNITFVRNTLTTTGSTDTPKR
NAINIGSNGKFTELRAAKNHTIFFYDPITSEGTSSDVLKINNGSAGALNP
YQGTILFSGETLTADELKVADNLKSSFTQPVSLSGGKLLLQKGVTLESTS
FSQEAGSLLGMDSGTTLSTTAGSITITNLGINVDSLGLKQPVSLTAKGAS
NKVIVSGKLNLIDIEGNIYESHMFSHDQLFSLLKITVDADVDTNVDISSL
IPVPAEDPNSEYGFQGQWNVNWTTDTATNTKEATATWTKTGFVPSPERKS
ALVCNTLWGVFTDIRSLQQLVEIGATGMEHKQGFWVSSMTNFLHKTGDEN
RKGFRHTSGGYVIGGSAHTPKDDLFTFAFCHLFARDKDCFIAHNNSRTYG
GTLFFKHSHTLQPQNYLRLGRAKFSESAIEKFPREIPLALDVQVSFSHSD
NRMETHYTSLPESEGSWSNECIAGGIGLDLPFVLSNPHPLFKTFIPQMKV
EMVYVSQNSFFESSSDGRGFSIGRLLNLSIPVGAKFVQGDIGDSYTYDLS
GFFVSDVYRNNPQSTATLVMSPDSWKIRGGNLSRQAFLLRGSNNYVYNSN
CELFGHYAMELRGSSRNYNVDVGTKLRF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGACTTCGATTCCTTGGGTTTTAGTTTCCTCCGTGTTAGCTTTCTC
ATGTCACCTACAGTCACTAGCTAACGAGGAACTTTTATCACCTGATGATA
GCTTTAATGGAAATATCGATTCAGGAACGTTTACTCCAAAAACTTCAGCC
ACAACATATTCTCTAACAGGAGATGTCTTCTTTTACGAGCCTGGAAAAGG
CACTCCCTTATCTGACAGTTGTTTTAAGCAAACCACGGACAATCTTACCT
TCTTGGGGAACGGTCATAGCTTAACGTTTGGCTTTATAGATGCTGGCACT
CATGCAGGTGCTGCTGCATCTACAACAGCAAATAAGAATCTTACCTTCTC
AGGGTTTTCCTTACTGAGTTTTGATTCCTCTCCTAGCACAACGGTTACTA
CAGGTCAGGGAACGCTTTCCTCAGCAGGAGGCGTAAATTTAGAAAATATT
CGTAAACTTGTAGTTGCTGGGAATTTTTCTACTGCAGATGGTGGAGCTAT
CAAAGGAGCGTCTTTCCTTTTAACTGGCACTTCTGGAGATGCTCTTTTTA
GTAACAACTCTTCATCAACAAAGGGAGGAGCAATTGCTACTACAGCAGGC
GCTCGCATAGCAAATAACACAGGTTATGTTAGATTCCTATCTAACATAGC
GTCTACGTCAGGAGGCGCTATCGATGATGAAGGCACGTCGATACTATCGA
ACAACAAATTTCTATATTTTGAAGGGAATGCAGCGAAAACTACTGGCGGT
GCGATCTGCAACACCAAGGCGAGTGGATCTCCTGAACTGATAATCTCTAA
CAATAAGACTCTGATCTTTGCTTCAAACGTAGCAGAAACAAGCGGTGGCG
CCATCCATGCTAAAAAGCTAGCCCTTTCCTCTGGAGGCTTTACAGAGTTT
CTACGAAATAATGTCTCATCAGCAACTCCTAAGGGGGGTGCTATCAGCAT
CGATGCCTCAGGAGAGCTCAGTCTTTCTGCAGAGACAGGAAACATTACCT
TTGTAAGAAATACCCTTACAACAACCGGAAGTACCGATACTCCTAAACGT
AATGCGATCAACATAGGAAGTAACGGGAAATTCACGGAATTACGGGCTGC
TAAAAATCATACAATTTTCTTCTATGATCCCATCACTTCAGAAGGAACCT
CATCAGACGTATTGAAGATAAATAACGGCTCTGCGGGAGCTCTCAATCCA
TATCAAGGAACGATTCTATTTTCTGGAGAAACCCTAACAGCAGATGAACT
TAAAGTTGCTGACAATTTAAAATCTTCATTCACGCAGCCAGTCTCCCTAT
CCGGAGGAAAGTTATTGCTACAAAAGGGAGTCACTTTAGAGAGCACGAGC
TTCTCTCAAGAGGCCGGTTCTCTCCTCGGCATGGATTCAGGAACGACATT
ATCAACTACAGCTGGGAGTATTACAATCACGAACCTAGGAATCAATGTTG
ACTCCTTAGGTCTTAAGCAGCCCGTCAGCCTAACAGCAAAAGGTGCTTCA
AATAAAGTGATCGTATCTGGGAAGCTCAACCTGATTGATATTGAAGGGAA
CATTTATGAAAGTCATATGTTCAGCCATGACCAGCTCTTCTCTCTATTAA
AAATCACGGTTGATGCTGATGTTGATACTAACGTTGACATCAGCAGCCTT
ATCCCTGTTCCTGCTGAGGATCCTAATTCAGAATACGGATTCCAAGGACA
ATGGAATGTTAATTGGACTACGGATACAGCTACAAATACAAAAGAGGCCA
CGGCAACTTGGACCAAAACAGGATTTGTTCCCAGCCCCGAAAGAAAATCT
GCGTTAGTATGCAATACCCTATGGGGAGTCTTTACTGACATTCGCTCTCT
GCAACAGCTTGTAGAGATCGGCGCAACTGGTATGGAACACAAACAAGGTT
TCTGGGTTTCCTCCATGACGAACTTCCTGCATAAGACTGGAGATGAAAAT
CGCAAAGGCTTCCGTCATACCTCTGGAGGCTACGTCATCGGTGGAAGTGC
TCACACTCCTAAAGACGACCTATTTACCTTTGCGTTCTGCCATCTCTTTG
CTAGAGACAAAGATTGTTTTATCGCTCACAACAACTCTAGAACCTACGGT
GGAACTTTATTCTTCAAGCACTCTCATACCCTACAACCCCAAAACTATTT
GAGATTAGGAAGAGCAAAGTTTTCTGAATCAGCTATAGAAAAATTCCCTA
GGGAAATTCCCCTAGCCTTGGATGTCCAAGTTTCGTTCAGCCATTCAGAC
AACCGTATGGAAACGCACTATACCTCATTGCCAGAATCCGAAGGTTCTTG
GAGCAACGAGTGTATAGCTGGTGGTATCGGCCTAGACCTTCCTTTTGTTC
TTTCCAACCCACATCCTCTTTTCAAGACCTTCATTCCACAGATGAAAGTC
GAAATGGTTTATGTATCACAAAATAGCTTCTTCGAAAGCTCTAGTGATGG
CCGTGGTTTTAGTATTGGAAGGCTGCTTAACCTCTCGATTCCTGTGGGTG
CGAAATTCGTGCAGGGGGATATCGGAGATTCCTACACCTATGATCTCTCA
GGATTCTTTGTTTCCGATGTCTATCGTAACAATCCCCAATCTACAGCGAC
TCTTGTGATGAGCCCAGACTCTTGGAAAATTCGCGGTGGCAATCTTTCAA
GACAGGCATTTTTACTGAGGGGTAGCAACAACTACGTCTACAACTCCAAT
TGTGAGCTCTTCGGACATTACGCTATGGAACTCCGTGGATCTTCAAGGAA
CTACAATGTAGATGTTGGTACCAAACTCCGATTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy