Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR358.1 IGR359 IGR357 IGR358 CPn0448 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0447 CPn0448 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0447 CPn0448 pmpG, - CPn0449 pmpA,pmpI, - CPn0452 pmpG, - CPn0451 pmpG, - CPn0447
* Calculated from Protein Sequence

Gene ID: CPn0449

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpG  

Definition:
polymorphic outer membrane protein G (outer membrane protein 5)

Gene Start:
508112

Gene Stop:
505325

Gene Length:
2787

Molecular Weight*:
0

pI*:
5.20

Net Charge*:
-14.06

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
This ORF was not recognized during the initial automated annotation process due to a single base deletion in the genomic sequence. The site of deletion was determined by comparing with GenBank record AJ133034.

Blast Summary:  PSI-Blast Search
CPn0449 is similar to CT871, CT874 CT412, CT872, CT413, CT869, CT812, CT870, CT414. They are all predicted outer membrane protein. No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0449 is paralogously related to seventeen other outer membrane proteins, namely, CPn0446, CPn0447, CPn0445, CPn0451, CPn0005, CPn0453, CPn0013, CPn0444, CPn0539, CPn0454, CPn0471, CPn0540, CPn0467, CPn0963,CPn0466, CPn0452, CPn0470.

Pfam Summary:  Pfam Search
Residues 2 to 429 (E-value = 1.8e-131) place CPn0449 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

PDB Hit:


Gene Protein Sequence:
MKSQFSWLVLSSTLACFTSCSTVFAATAENIGPSDSFDGSTNTGTYTPKN
TTTGIDYTLTGDITLQNLGDSAALTKGCFSDTTESLSFAGKGYSLSFLNI
KSSAEGAALSVTTDKNLSLTGFSSLTFLAAPSSVITTPSGKGAVKCGGDL
TFDNNGTILFKQDYCEENGGAISTKNLSLKNSTGSISFEGNKSSATGKKG
GAICATGTVDITNNTAPTLFSNNIAEAAGGAINSTGNCTITGNTSLVFSE
NSVTATAGNGGALSGDADVTISGNQSVTFSGNQAVANGGAIYAKKLTLAS
GGGGGISFSNNIVQGTTAGNGGAISILAAGECSLSAEAGDITFNGNAIVA
TTPQTTKRNSIDIGSTAKITNLRAISGHSIFFYDPITANTAADSTDTLNL
NKADAGNSTDYSGSIVFSGEKLSEDEAKVADNLTSTLKQPVTLTAGNLVL
KRGVTLDTKGFTQTAGSSVIMDAGTTLKASTEEVTLTGLSIPVDSLGEGK
KVVIAASAASKNVALSGPILLLDNQGNAYENHDLGKTQDFSFVQLSALGT
ATTTDVPAVPTVATPTHYGYQGTWGMTWVDDTASTPKTKTATLAWTNTGY
LPNPERQGPLVPNSLWGSFSDIQAIQGVIERSALTLCSDRGFWAAGVANF
LDKDKKGEKRKYRHKSGGYAIGGAAQTCSENLISFAFCQLFGSDKDFLVA
KNHTDTYAGAFYIQHITECSGFIGCLLDKLPGSWSHKPLVLEGQLAYSHV
SNDLKTKYTAYPEVKGSWGNNAFNMMLGASSHSYPEYLHCFDTYAPYIKL
NLTYIRQDSFSEKGTEGRSFDDSNLFNLSLPIGVKFEKFSDCNDFSYDLT
LSYVPDLIRNDPKCTTALVISGASWETYANNLARQALQVRAGSHYAFSPM
FEVLGQFVFEVRGSSRIYNVDLGGKFQF*

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATCGCAATTTTCCTGGTTAGTGCTCTCTTCGACATTGGCATGTTT
TACTAGTTGTTCCACTGTTTTTGCTGCAACTGCTGAAAATATAGGCCCCT
CTGATAGCTTTGACGGAAGTACTAACACAGGCACCTATACTCCTAAAAAT
ACGACTACTGGAATAGACTATACTCTGACAGGAGATATAACTCTGCAAAA
CCTTGGGGATTCGGCAGCTTTAACGAAGGGTTGTTTTTCTGACACTACGG
AATCTTTAAGCTTTGCCGGTAAGGGGTACTCACTTTCTTTTTTAAATATT
AAGTCTAGTGCTGAAGGCGCAGCACTTTCTGTTACAACTGATAAAAATCT
GTCGCTAACAGGATTTTCGAGTCTTACTTTCTTAGCGGCCCCATCATCGG
TAATCACAACCCCCTCAGGAAAAGGTGCAGTTAAATGTGGAGGGGATCTT
ACATTTGATAACAATGGAACTATTTTATTTAAACAAGATTACTGTGAGGA
AAATGGCGGAGCCATTTCTACCAAGAATCTTTCTTTGAAAAACAGCACGG
GATCGATTTCTTTTGAAGGGAATAAATCGAGCGCAACAGGGAAAAAAGGT
GGGGCTATTTGTGCTACTGGTACTGTAGATATTACAAATAATACGGCTCC
TACCCTCTTCTCGAACAATATTGCTGAAGCTGCAGGTGGAGCTATAAATA
GCACAGGAAACTGTACAATTACAGGGAATACGTCTCTTGTATTTTCTGAA
AATAGTGTGACAGCGACCGCAGGAAATGGAGGAGCTCTTTCTGGAGATGC
CGATGTTACCATATCTGGGAATCAGAGTGTAACTTTCTCAGGAAACCAAG
CTGTAGCTAATGGCGGAGCCATTTATGCTAAGAAGCTTACACTGGCTTCC
GGGGGGGGGGGGGGTATCTCCTTTTCTAACAATATAGTCCAAGGTACCAC
TGCAGGTAATGGTGGAGCCATTTCTATACTGGCAGCTGGAGAGTGTAGTC
TTTCAGCAGAAGCAGGGGACATTACCTTCAATGGGAATGCCATTGTTGCA
ACTACACCACAAACTACAAAAAGAAATTCTATTGACATAGGATCTACTGC
AAAGATCACGAATTTACGTGCAATATCTGGGCATAGCATCTTTTTCTACG
ATCCGATTACTGCTAATACGGCTGCGGATTCTACAGATACTTTAAATCTC
AATAAGGCTGATGCAGGTAATAGTACAGATTATAGTGGGTCGATTGTTTT
TTCTGGTGAAAAGCTCTCTGAAGATGAAGCAAAAGTTGCAGACAACCTCA
CTTCTACGCTGAAGCAGCCTGTAACTCTAACTGCAGGAAATTTAGTACTT
AAACGTGGTGTCACTCTCGATACGAAAGGCTTTACTCAGACCGCGGGTTC
CTCTGTTATTATGGATGCGGGCACAACGTTAAAAGCAAGTACAGAGGAGG
TCACTTTAACAGGTCTTTCCATTCCTGTAGACTCTTTAGGCGAGGGTAAG
AAAGTTGTAATTGCTGCTTCTGCAGCAAGTAAAAATGTAGCCCTTAGTGG
TCCGATTCTTCTTTTGGATAACCAAGGGAATGCTTATGAAAATCACGACT
TAGGAAAAACTCAAGACTTTTCATTTGTGCAGCTCTCTGCTCTGGGTACT
GCAACAACTACAGATGTTCCAGCGGTTCCTACAGTAGCAACTCCTACGCA
CTATGGGTATCAAGGTACTTGGGGAATGACTTGGGTTGATGATACCGCAA
GCACTCCAAAGACTAAGACAGCGACATTAGCTTGGACCAATACAGGCTAC
CTTCCGAATCCTGAGCGTCAAGGACCTTTAGTTCCTAATAGCCTTTGGGG
ATCTTTTTCAGACATCCAAGCGATTCAAGGTGTCATAGAGAGAAGTGCTT
TGACTCTTTGTTCAGATCGAGGCTTCTGGGCTGCGGGAGTCGCCAATTTC
TTAGATAAAGATAAGAAAGGGGAAAAACGCAAATACCGTCATAAATCTGG
TGGATATGCTATCGGAGGTGCAGCGCAAACTTGTTCTGAAAACTTAATTA
GCTTTGCCTTTTGCCAACTCTTTGGTAGCGATAAAGATTTCTTAGTCGCT
AAAAATCATACTGATACCTATGCAGGAGCCTTCTATATCCAACACATTAC
AGAATGTAGTGGGTTCATAGGTTGTCTCTTAGATAAACTTCCTGGCTCTT
GGAGTCATAAACCCCTCGTTTTAGAAGGGCAGCTCGCTTATAGCCACGTC
AGTAATGATCTGAAGACAAAGTATACTGCGTATCCTGAGGTGAAAGGTTC
TTGGGGGAATAATGCTTTTAACATGATGTTGGGAGCTTCTTCTCATTCTT
ATCCTGAATACCTGCATTGTTTTGATACCTATGCTCCATACATCAAACTG
AATCTGACCTATATACGTCAGGACAGCTTCTCGGAGAAAGGTACAGAAGG
AAGATCTTTTGATGACAGCAACCTCTTCAATTTATCTTTGCCTATAGGGG
TGAAGTTTGAGAAGTTCTCTGATTGTAATGACTTTTCTTATGATCTGACT
TTATCCTATGTTCCTGATCTTATCCGCAATGATCCCAAATGCACTACAGC
ACTTGTAATCAGCGGAGCCTCTTGGGAAACTTATGCCAATAACTTAGCAC
GACAGGCCTTGCAAGTGCGTGCAGGCAGTCACTACGCCTTCTCTCCTATG
TTTGAAGTGCTCGGCCAGTTTGTCTTTGAAGTTCGTGGATCCTCACGGAT
TTATAATGTAGATCTTGGGGGTAAGTTCCAATTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy