Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR356 IGR358.1 IGR357 IGR358 CPn0448 pmpG, - CPn0449 pmpG, - CPn0451 pmpG, - CPn0447 pmpG, - CPn0446 CPn0448 pmpG, - CPn0449 pmpG, - CPn0451 pmpG, - CPn0447 pmpG, - CPn0446 CPn0448 pmpG, - CPn0449 pmpG, - CPn0451 pmpG, - CPn0447 pmpG, - CPn0446
* Calculated from Protein Sequence

Gene ID: CPn0448

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
504810

Gene Stop:
503695

Gene Length:
1116

Molecular Weight*:
43525

pI*:
5.10

Net Charge*:
-14.50

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
This sequence has been sequenced previously and appears in PSI-BLAST as a hit in which residues 4-371 are 100% similar to residues 1-368 of (AJ133034) hypothetical protein [Chlamydia pneumoniae].

Blast Summary:  PSI-Blast Search
The significant hits to hypothetical proteins in gapped BLAST outside of C.pneumoniae are: residues 16-317 are 33% similar to YXJG_BACSU (P42318); and residues 16-317 are 29% similar to YXJH_BACSU (P42319). No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0620
COG name: Methionine synthase II (cobalamin-independent)
Functional Class:  E
The phylogenetic pattern of COG0620 is amtKyqv-eBrh-------N-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 16-317 are 35% similar to the katB 3'region of YXJG_BACSU.

Paralogs:  Local Blast Search
One hypothetical protein sequence in C.pneumoniae shows significant evidence of paralogy:

Residues 3-370 are 55% similar to residues 1-373 of (AE001600) hypothetical protein [Chlamydia pneumoniae], also identified as CPn0143.



Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MEMMSPFQQPEQCHFDVVGSFLRPESLTRARSDFEEGRIVYEQMRVVEDA
AIRNLIKKQTEAGLIFFTDGEFRRYSWDFDFMWGFHGVDRRRDSNDPEIG
VYLKDKISVSKHPFIEHFEFVKTFEKGNAKAKQTIPSPSQFFHEMIFAPN
LKNTRKFYPTNQELIDDIVFYYRQVIQDLYAAGCRNLQLDDCAWCRLLDI
RAPSWYGVDSHDRLQEILEQFLWIHNLVMKDRPEDLFVSLHVCRGDYQAE
FFSRRAYDSIEEPLFAKTDVDSYHYYWALDDKYSGGAEPLAYVSGEKHVC
LGLISSNHSCIEDRDAVVSRIYEAASYIPLERLSLSPQCGFASCEGDHRM
TEEEQWKKIAFVKEIAKEIWG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAATGATGAGCCCATTCCAACAACCTGAGCAATGTCATTTTGATGT
TGTGGGAAGTTTCTTACGTCCTGAAAGTCTTACACGAGCACGCTCTGATT
TTGAAGAAGGAAGAATTGTCTATGAGCAGATGCGAGTTGTCGAAGATGCT
GCTATTCGTAATCTCATAAAAAAGCAAACAGAAGCAGGTCTTATCTTTTT
TACTGATGGGGAATTCCGTAGGTATAGTTGGGATTTCGACTTTATGTGGG
GATTCCATGGCGTGGATCGTCGCAGGGACTCTAATGACCCTGAAATTGGA
GTGTATCTTAAAGATAAAATCTCCGTATCAAAACATCCGTTTATAGAACA
TTTCGAGTTTGTCAAAACTTTTGAGAAGGGAAATGCAAAAGCAAAACAAA
CGATTCCTTCTCCATCACAATTTTTCCATGAGATGATTTTTGCTCCTAAT
CTGAAAAATACTCGGAAGTTTTATCCTACGAATCAAGAGCTAATTGATGA
TATTGTCTTTTATTATCGCCAAGTCATCCAAGATCTTTATGCTGCAGGTT
GTCGTAATTTGCAGTTGGACGATTGTGCTTGGTGTCGCCTCTTGGATATA
CGAGCGCCTTCTTGGTATGGTGTTGATTCTCATGACAGGTTGCAGGAAAT
TTTAGAACAGTTTTTATGGATCCATAATTTAGTGATGAAGGATAGACCCG
AGGATCTTTTTGTAAGTCTGCATGTCTGTCGTGGTGATTATCAGGCCGAG
TTTTTCTCTAGACGAGCTTATGATTCTATAGAGGAGCCTTTATTTGCTAA
GACCGATGTGGATAGTTATCACTATTATTGGGCTCTTGATGATAAGTATT
CAGGAGGTGCTGAGCCTTTAGCTTACGTCTCTGGAGAGAAACACGTCTGC
TTGGGATTGATCTCCAGCAACCATTCTTGTATTGAAGATCGAGATGCTGT
GGTTTCTCGTATTTATGAAGCTGCGAGCTACATTCCCTTAGAGAGACTTT
CTTTGAGCCCGCAATGTGGGTTTGCTTCTTGTGAGGGAGACCATAGAATG
ACTGAAGAAGAACAGTGGAAGAAGATCGCCTTTGTGAAAGAGATTGCTAA
AGAGATCTGGGGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy