Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR355 IGR356 IGR354 IGR357 CPn0448 pmpG, - CPn0447 pmpG, - CPn0446 pmpG, - CPn0445 pmpG, - CPn0444 CPn0448 pmpG, - CPn0447 pmpG, - CPn0446 pmpG, - CPn0445 pmpG, - CPn0444 CPn0448 pmpG, - CPn0447 pmpG, - CPn0446 pmpG, - CPn0445 pmpG, - CPn0444
* Calculated from Protein Sequence

Gene ID: CPn0446

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpG  

Definition:
outer membrane protein G

Gene Start:
497626

Gene Stop:
500418

Gene Length:
2793

Molecular Weight*:
97666

pI*:
5.30

Net Charge*:
-13.49

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0446 is similar to CT871, CT874, CT869, CT412, CT872, CT413, CT812, CT870, and CT414. They are all predicted polymorphic outer membrane proteins. CT871 is a predicted pmpG outer membrane protein G. Residues 1-930 are 28% similar to CT871.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0446 is paralogously related to CPn0447, CPn0445, CPn0451,CPn0005, CPn0453, CPn0013, CPn0444, CPn0539,CPn0471, CPn0466, CPn0454, CPn0963, CPn0467,CPn0540, CPn0452, CPn0470. They are all predicted polymorphic outer membrane proteins.

Pfam Summary:  Pfam Search
Residues 2 to 431 (E-value = 1.5e-133) place CPn0446 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
26
non-globular  
27  
529

PDB Hit:


Gene Protein Sequence:
MKIPLHKLLISSTLVTPILLSIATYGADASLSPTDSFDGAGGSTFTPKST
ADANGTNYVLSGNVYINDAGKGTALTGCCFTETTGDLTFTGKGYSFSFNT
VDAGSNAGAAASTTADKALTFTGFSNLSFIAAPGTTVASGKSTLSSAGAL
NLTDNGTILFSQNVSNEANNNGGAITTKTLSISGNTSSITFTSNSAKKLG
GAIYSSAAASISGNTGQLVFMNNKGETGGGALGFEASSSITQNSSLFFSG
NTATDAAGKGGAIYCEKTGETPTLTISGNKSLTFAENSSVTQGGAICAHG
LDLSAAGPTLFSNNRCGNTAAGKGGAIAIADSGSLSLSANQGDITFLGNT
LTSTSAPTSTRNAIYLGSSAKITNLRAAQGQSIYFYDPIASNTTGASDVL
TINQPDSNSPLDYSGTIVFSGEKLSADEAKAADNFTSILKQPLALASGTL
ALKGNVELDVNGFTQTEGSTLLMQPGTKLKADTEAISLTKLVVDLSALEG
NKSVSIETAGANKTITLTSPLVFQDSSGNFYESHTINQAFTQPLVVFTAA
TAASDIYIDALLTSPVQTPEPHYGYQGHWEATWADTSTAKSGTMTWVTTG
YNPNPERRASVVPDSLWASFTDIRTLQQIMTSQANSIYQQRGLWASGTAN
FFHKDKSGTNQAFRHKSYGYIVGGSAEDFSENIFSVAFCQLFGKDKDLFI
VENTSHNYLASLYLQHRAFLGGLPMPSFGSITDMLKDIPLILNAQLSYSY
TKNDMDTRYTSYPEAQGSWTNNSGALELGGSLALYLPKEAPFFQGYFPFL
KFQAVYSRQQNFKESGAEARAFDDGDLVNCSIPVGIRLEKISEDEKNNFE
ISLAYIGDVYRKNPRSRTSLMVSGASWTSLCKNLARQAFLASAGSHLTLS
PHVELSGEAAYELRGSAHIYNVDCGLRYSF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATACCCTTGCACAAACTCCTGATCTCTTCGACTCTTGTCACTCC
CATTCTATTGAGCATTGCAACTTACGGAGCAGATGCTTCTTTATCCCCTA
CAGATAGCTTTGATGGAGCGGGCGGCTCTACATTTACTCCAAAATCTACA
GCAGATGCCAATGGAACGAACTATGTCTTATCAGGAAATGTCTATATAAA
CGATGCTGGGAAAGGCACAGCATTAACAGGCTGCTGCTTTACAGAAACTA
CGGGTGATCTGACATTTACTGGAAAGGGATACTCATTTTCATTCAACACG
GTAGATGCGGGTTCGAATGCAGGAGCTGCGGCAAGCACAACTGCTGATAA
AGCCCTAACATTCACAGGATTTTCTAACCTTTCCTTCATTGCAGCTCCTG
GAACTACAGTTGCTTCAGGAAAAAGTACTTTAAGTTCTGCAGGAGCCTTA
AATCTTACCGATAATGGAACGATTCTCTTTAGCCAAAACGTCTCCAATGA
AGCTAATAACAATGGCGGAGCGATCACCACAAAAACTCTTTCTATTTCTG
GGAATACCTCTTCTATAACCTTCACTAGTAATAGCGCAAAAAAATTAGGT
GGAGCGATCTATAGCTCTGCGGCTGCAAGTATTTCAGGAAACACCGGCCA
GTTAGTCTTTATGAATAATAAAGGAGAAACTGGGGGTGGGGCTCTGGGCT
TTGAAGCCAGCTCCTCGATTACTCAAAATAGCTCCCTTTTCTTCTCTGGA
AACACTGCAACAGATGCTGCAGGCAAGGGCGGGGCCATTTATTGTGAAAA
AACAGGAGAGACTCCTACTCTTACTATCTCTGGAAATAAAAGTCTGACCT
TCGCCGAGAACTCTTCAGTAACTCAAGGCGGAGCAATCTGTGCCCATGGT
CTAGATCTTTCCGCTGCTGGCCCTACCCTATTTTCAAATAATAGATGCGG
GAACACAGCTGCAGGCAAGGGCGGCGCTATTGCAATTGCCGACTCTGGAT
CTTTAAGTCTCTCTGCAAATCAAGGAGACATCACGTTCCTTGGCAACACT
CTAACCTCAACCTCCGCGCCAACATCGACACGGAATGCTATCTACCTGGG
ATCGTCAGCAAAAATTACGAACTTAAGGGCAGCCCAAGGCCAATCTATCT
ATTTCTATGATCCGATTGCATCTAACACCACAGGAGCTTCAGACGTTCTG
ACCATCAACCAACCGGATAGCAACTCGCCTTTAGATTATTCAGGAACGAT
TGTATTTTCTGGGGAAAAGCTCTCTGCAGATGAAGCGAAAGCTGCTGATA
ACTTCACATCTATATTAAAGCAACCATTGGCTCTAGCCTCTGGAACCTTA
GCACTCAAAGGAAATGTCGAGTTAGATGTCAATGGTTTCACACAGACTGA
AGGCTCTACACTCCTCATGCAACCAGGAACAAAGCTCAAAGCAGATACTG
AAGCTATCAGTCTTACCAAACTTGTCGTTGATCTTTCTGCCTTAGAGGGA
AATAAGAGTGTGTCCATTGAAACAGCAGGAGCCAACAAAACTATAACTCT
AACCTCTCCTCTTGTTTTCCAAGATAGTAGCGGCAATTTTTATGAAAGCC
ATACGATAAACCAAGCCTTCACGCAGCCTTTGGTGGTATTCACTGCTGCT
ACTGCTGCTAGCGATATTTATATCGATGCGCTTCTCACTTCTCCAGTACA
AACTCCAGAACCTCATTACGGGTATCAGGGACATTGGGAAGCCACTTGGG
CAGACACATCAACTGCAAAATCAGGAACTATGACTTGGGTAACTACGGGC
TACAACCCTAATCCTGAGCGTAGAGCTTCCGTAGTTCCCGATTCATTATG
GGCATCCTTTACTGACATTCGCACTCTACAGCAGATCATGACATCTCAAG
CGAATAGTATCTATCAGCAACGAGGACTCTGGGCATCAGGAACTGCGAAT
TTCTTCCATAAGGATAAATCAGGAACTAACCAAGCATTCCGACATAAAAG
CTACGGCTATATTGTTGGAGGAAGTGCTGAAGATTTTTCTGAAAATATCT
TCAGTGTAGCTTTCTGCCAGCTCTTCGGTAAAGATAAAGACCTGTTTATA
GTTGAAAATACCTCTCATAACTATTTAGCGTCGCTATACCTGCAACATCG
AGCATTCCTAGGAGGACTTCCCATGCCCTCATTTGGAAGTATCACCGACA
TGCTGAAAGATATTCCTCTCATTTTGAATGCCCAGCTAAGCTACAGCTAC
ACTAAAAATGATATGGATACTCGCTATACTTCCTATCCTGAAGCTCAAGG
CTCTTGGACCAATAACTCTGGGGCTCTAGAGCTCGGAGGATCTCTGGCTC
TATATCTCCCTAAAGAAGCACCGTTCTTCCAGGGATATTTCCCCTTCTTA
AAGTTCCAGGCAGTCTACAGCCGCCAACAAAACTTTAAAGAGAGTGGCGC
TGAAGCCCGTGCTTTTGATGATGGAGACCTAGTGAACTGCTCTATCCCTG
TCGGCATTCGGTTAGAAAAAATCTCCGAAGATGAAAAAAATAATTTCGAG
ATTTCTCTAGCCTACATTGGTGATGTGTATCGTAAAAATCCCCGTTCGCG
TACTTCTCTAATGGTCAGTGGAGCCTCTTGGACTTCGCTATGTAAAAACC
TCGCACGACAAGCCTTCTTAGCAAGTGCTGGAAGCCATCTGACTCTCTCC
CCTCATGTAGAACTCTCTGGGGAAGCTGCTTATGAGCTTCGTGGCTCAGC
ACACATCTACAATGTAGATTGTGGGCTAAGATACTCATTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy