Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR355 IGR356 IGR354 pmpG, - CPn0447 pmpG, - CPn0446 pmpG, - CPn0445 pmpG, - CPn0444 pmpG, - CPn0447 pmpG, - CPn0446 pmpG, - CPn0445 pmpG, - CPn0444 Type: tandem, Name:  - 7 pmpG, - CPn0447 pmpG, - CPn0446 pmpG, - CPn0445 pmpG, - CPn0444
* Calculated from Protein Sequence

Gene ID: CPn0445

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpG  

Definition:
outer membrane protein G

Gene Start:
494772

Gene Stop:
497582

Gene Length:
2811

Molecular Weight*:
100076

pI*:
6.00

Net Charge*:
-8.82

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0445 is similar to CT871, CT874, CT869, CT872, CT412, CT413, CT870, CT812, and CT414. CT871 is a predicted pmpG outer membrane protein G. Residues 1-936 are 28% similar to CT871.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0445 is paralogously related to CPn0446, CPn0447, CPn0451, CPn0005, CPn0453, CPn0013, CPn0444, CPn0539, CPn0471, CPn0963, CPn0454, CPn0466, CPn0540, CPn0467, CPn0452, CPn0470. They are all predicted polymorphic outer membrane proteins.

Pfam Summary:  Pfam Search
Residues 2 to 431 (E-value = 1.4e-201) place CPn0445 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23
non-globular  
24  
411
non-globular  
445  
600

PDB Hit:


Gene Protein Sequence:
MKSSVSWLFFSSIPLFSSLSIVAAEVTLDSSNNSYDGSNGTTFTVFSTTD
AAAGTTYSLLSDVSFQNAGALGIPLASGCFLEAGGDLTFQGNQHALKFAF
INAGSSAGTVASTSAADKNLLFNDFSRLSIISCPSLLLSPTGQCALKSVG
NLSLTGNSQIIFTQNFSSDNGGVINTKNFLLSGTSQFASFSRNQAFTGKQ
GGVVYATGTITIENSPGIVSFSQNLAKGSGGALYSTDNCSITDNFQVIFD
GNSAWEAAQAQGGAICCTTTDKTVTLTGNKNLSFTNNTALTYGGAISGLK
VSISAGGPTLFQSNISGSSAGQGGGGAINIASAGELALSATSGDITFNNN
QVTNGSTSTRNAINIIDTAKVTSIRAATGQSIYFYDPITNPGTAASTDTL
NLNLADANSEIEYGGAIVFSGEKLSPTEKAIAANVTSTIRQPAVLARGDL
VLRDGVTVTFKDLTQSPGSRILMDGGTTLSAKEANLSLNGLAVNLSSLDG
TNKAALKTEAADKNISLSGTIALIDTEGSFYENHNLKSASTYPLLELTTA
GANGTITLGALSTLTLQEPETHYGYQGNWQLSWANATSSKIGSINWTRTG
YIPSPERKSNLPLNSLWGNFIDIRSINQLIETKSSGEPFERELWLSGIAN
FFYRDSMPTRHGFRHISGGYALGITATTPAEDQLTFAFCQLFARDRNHIT
GKNHGDTYGASLYFHHTEGLFDIANFLWGKATRAPWVLSEISQIIPLSFD
AKFSYLHTDNHMKTYYTDNSIIKGSWRNDAFCADLGASLPFVISVPYLLK
EVEPFVKVQYIYAHQQDFYERHAEGRAFNKSELINVEIPIGVTFERDSKS
EKGTYDLTLMYILDAYRRNPKCQTSLIASDANWMAYGTNLARQGFSVRAA
NHFQVNPHMEIFGQFAFEVRSSSRNYNTNLGSKFCF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTCCTCTGTCTCTTGGTTGTTCTTTTCTTCAATCCCGCTCTTTTC
ATCGCTCTCTATAGTCGCGGCAGAGGTGACCTTAGATAGCAGCAATAATA
GCTATGATGGATCTAACGGAACTACCTTCACGGTCTTTTCCACTACGGAC
GCTGCTGCAGGAACTACCTATTCCTTACTTTCCGACGTATCCTTTCAAAA
TGCAGGGGCTTTAGGAATTCCCTTAGCCTCAGGATGCTTCCTAGAAGCGG
GCGGCGATCTTACTTTCCAAGGAAATCAACATGCACTGAAGTTTGCATTT
ATCAATGCGGGCTCTAGCGCTGGAACTGTAGCCAGTACCTCAGCAGCAGA
TAAGAATCTTCTCTTTAATGATTTTTCTAGACTCTCTATTATCTCTTGTC
CCTCTCTTCTTCTCTCTCCTACTGGACAATGTGCTTTAAAATCTGTGGGG
AATCTATCTCTAACTGGCAATTCCCAAATTATATTTACTCAGAACTTCTC
GTCAGATAACGGCGGTGTTATCAATACGAAAAACTTCTTATTATCAGGGA
CATCTCAGTTTGCGAGCTTTTCGAGAAACCAAGCCTTCACAGGGAAGCAA
GGCGGTGTAGTTTACGCTACAGGAACTATAACTATCGAGAACAGCCCTGG
GATAGTTTCCTTCTCTCAAAACCTAGCGAAAGGATCTGGCGGTGCTCTGT
ACAGCACTGACAACTGTTCGATTACAGATAACTTTCAAGTGATCTTTGAC
GGCAATAGTGCTTGGGAAGCCGCTCAAGCTCAGGGCGGGGCTATTTGTTG
CACTACGACAGATAAAACAGTGACTCTTACTGGGAACAAAAACCTCTCTT
TCACAAATAATACAGCATTGACATATGGCGGAGCCATCTCTGGACTCAAG
GTCAGTATTTCCGCTGGAGGTCCTACTCTATTTCAAAGTAATATCTCAGG
AAGTAGCGCCGGTCAGGGAGGAGGAGGAGCGATCAATATAGCATCTGCTG
GGGAACTCGCTCTCTCTGCTACTTCTGGAGATATTACCTTCAATAACAAC
CAAGTCACCAACGGAAGCACAAGTACAAGAAACGCAATAAATATCATTGA
TACCGCTAAAGTCACATCGATACGAGCTGCTACGGGGCAATCTATCTATT
TCTATGATCCCATCACAAATCCAGGAACCGCAGCTTCTACCGACACATTG
AACTTAAACTTAGCAGATGCGAACAGTGAGATCGAGTATGGGGGTGCGAT
TGTCTTTTCTGGAGAAAAGCTTTCCCCTACAGAAAAAGCAATCGCTGCAA
ACGTCACCTCTACTATCCGACAACCTGCAGTATTAGCGCGGGGAGATCTT
GTACTTCGTGATGGAGTCACCGTAACTTTCAAGGATCTGACTCAAAGTCC
AGGATCCCGCATCTTAATGGATGGGGGGACTACACTTAGTGCTAAAGAGG
CAAATCTTTCGCTTAATGGCTTAGCAGTAAATCTCTCCTCTTTAGATGGA
ACCAACAAGGCAGCTTTAAAAACAGAAGCTGCAGATAAAAATATCAGCCT
ATCGGGAACGATTGCGCTTATTGACACGGAAGGGTCATTCTATGAGAATC
ATAACTTAAAAAGTGCTAGTACCTATCCTCTTCTTGAACTTACCACCGCA
GGAGCCAACGGAACGATTACTCTGGGAGCTCTTTCTACCCTGACTCTTCA
AGAACCTGAAACCCACTACGGGTATCAAGGAAACTGGCAGTTGTCTTGGG
CAAATGCAACATCCTCAAAAATAGGAAGCATCAACTGGACCCGTACAGGA
TACATTCCTAGTCCTGAGAGAAAAAGTAATCTCCCTCTAAATAGCTTATG
GGGAAACTTTATAGATATACGCTCGATCAATCAGCTTATAGAAACCAAGT
CCAGTGGGGAGCCTTTTGAGCGTGAGCTATGGCTTTCAGGAATTGCGAAT
TTCTTCTATAGAGATTCTATGCCCACCCGCCATGGTTTCCGCCATATCAG
CGGGGGTTATGCACTAGGGATCACAGCAACAACTCCTGCCGAGGATCAGC
TTACTTTTGCCTTCTGCCAGCTCTTTGCTAGAGATCGCAATCATATTACA
GGTAAGAACCACGGAGATACTTACGGTGCCTCTTTGTATTTCCACCATAC
AGAAGGGCTCTTCGACATCGCCAATTTCCTCTGGGGAAAAGCAACCCGAG
CTCCCTGGGTGCTCTCTGAGATCTCCCAGATCATTCCTTTATCGTTCGAT
GCTAAATTCAGTTATCTCCATACAGACAACCACATGAAGACATATTATAC
CGATAACTCTATCATCAAGGGTTCTTGGAGAAACGATGCCTTCTGTGCAG
ATCTTGGAGCTAGCCTGCCTTTTGTTATTTCCGTTCCGTATCTTCTGAAA
GAAGTCGAACCTTTTGTCAAAGTACAGTATATCTATGCGCATCAGCAAGA
CTTCTACGAGCGTCATGCTGAAGGACGCGCTTTCAATAAAAGCGAGCTTA
TCAACGTAGAGATTCCTATAGGCGTCACCTTCGAAAGAGACTCAAAATCA
GAAAAGGGAACTTACGATCTTACTCTTATGTATATACTCGATGCTTACCG
ACGCAATCCTAAATGTCAAACTTCCCTAATAGCTAGCGATGCTAACTGGA
TGGCCTATGGTACCAACCTCGCACGACAAGGTTTTTCTGTTCGTGCTGCG
AACCATTTCCAAGTGAACCCCCACATGGAAATCTTCGGTCAATTCGCTTT
TGAAGTACGAAGTTCTTCACGAAATTATAATACAAACCTAGGCTCTAAGT
TTTGTTTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy