Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR351 IGR352 IGR354 IGR353 CPn0442 CPn0441 CPn0443 pmpG, - CPn0445 pmpG, - CPn0444 CPn0442 CPn0441 CPn0443 pmpG, - CPn0445 pmpG, - CPn0444 Type: tandem, Name:  - 7 CPn0441 CPn0443 pmpG, - CPn0445 pmpG, - CPn0444 CPn0442
* Calculated from Protein Sequence

Gene ID: CPn0444

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpG  

Definition:
outer membrane protein G

Gene Start:
490287

Gene Stop:
494510

Gene Length:
4224

Molecular Weight*:
144922

pI*:
5.40

Net Charge*:
-22.34

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0444 is similar to CT871, CT874, CT413, CT812, CT872, CT414, CT412, CT870, CT869, and CT456. They are predicted outer membrane proteins. CT871 is a predicted pmpG outer membrane protein G. Residues 470-1407 are 28% similar to CT871.

No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0444 is paralogously related to CPn0453, CPn0446, CPn0445, CPn0447, CPn0451, CPn0005, CPn0013, CPn0540, CPn0963, CPn0454, CPn0467, CPn0471, CPn0466, CPn0539, CPn0452, CPn0470. They are all predicted polymorphic outer membrane proteins.

Pfam Summary:  Pfam Search
Residues 2 to 436 (E-value = 4.4e-166) place CPn0444 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)
Residues 439 to 860 (E-value = 9.1e-18) place CPn0444 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23
non-globular  
24  
1010

PDB Hit:


Gene Protein Sequence:
MKYSLPWLLTSSALVFSLHPLMAANTDLSSSDNYENGSSGSAAFTAKETS
DASGTTYTLTSDVSITNVSAITPADKSCFTNTGGALSFVGADHSLVLQTI
ALTHDGAAINNTNTALSFSGFSSLLIDSAPATGTSGGKGAICVTNTEGGT
ATFTDNASVTLQKNTSEKDGAAVSAYSIDLAKTTTAALLDQNTSTKNGGA
LCSTANTTVQGNSGTVTFSSNTATDKGGGIYSKEKDSTLDANTGVVTFKS
NTAKTGGAWSSDDNLALTGNTQVLFQENKTTGSAAQANNPEGCGGAICCY
LATATDKTGLAISQNQEMSFTSNTTTANGGAIYATKCTLDGNTTLTFDQN
TATAGCGGAIYTETEDFSLKGSTGTVTFSTNTAKTGGALYSKGNSSLTGN
TNLLFSGNKATGPSNSSANQEGCGGAILAFIDSGSVSDKTGLSIANNQEV
SLTSNAATVSGGAIYATKCTLTGNGSLTFDGNTAGTSGGAIYTETEDFTL
TGSTGTVTFSTNTAKTGGALYSKGNNSLSGNTNLLFSGNKATGPSNSSAN
QEGCGGAILSFLESASVSTKKGLWIEDNENVSLSGNTATVSGGAIYATKC
ALHGNTTLTFDGNTAETAGGAIYTETEDFTLTGSTGTVTFSTNTAKTAGA
LHTKGNTSFTKNKALVFSGNSATATATTTTDQEGCGGAILCNISESDIAT
KSLTLTENESLSFINNTAKRSGGGIYAPKCVISGSESINFDGNTAETSGG
AIYSKNLSITANGPVSFTNNSGGKGGAIYIADSGELSLEAIDGDITFSGN
RATEGTSTPNSIHLGAGAKITKLAAAPGHTIYFYDPITMEAPASGGTIEE
LVINPVVKAIVPPPQPKNGPIASVPVVPVAPANPNTGTIVFSSGKLPSQD
ASIPANTTTILNQKINLAGGNVVLKEGATLQVYSFTQQPDSTVFMDAGTT
LETTTTNNTDGSIDLKNLSVNLDALDGKRMITIAVNSTSGGLKISGDLKF
HNNEGSFYDNPGLKANLNLPFLDLSSTSGTVNLDDFNPIPSSMAAPDYGY
QGSWTLVPKVGAGGKVTLVAEWQALGYTPKPELRATLVPNSLWNAYVNIH
SIQQEIATAMSDAPSHPGIWIGGIGNAFHQDKQKENAGFRLISRGYIVGG
SMTTPQEYTFAVAFSQLFGKSKDYVVSDIKSQVYAGSLCAQSSYVIPLHS
SLRRHVLSKVLPELPGETPLVLHGQVSYGRNHHNMTTKLANNTQGKSDWD
SHSFAVEVGGSLPVDLNYRYLTSYSPYVKLQVVSVNQKGFQEVAADPRIF
DASHLVNVSIPMGLTFKHESAKPPSALLLTLGYAVDAYRDHPHCLTSLTN
GTSWSTFATNLSRQAFFAEASGHLKLLHGLDCFASGSCELRSSSRSYNAN
CGTRYSF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATATTCTTTACCTTGGCTACTTACCTCTTCGGCTTTAGTTTTCTC
CCTACATCCACTAATGGCTGCTAACACGGATCTCTCATCATCCGATAACT
ATGAAAATGGTAGTAGTGGTAGCGCAGCATTCACTGCCAAGGAAACTTCG
GATGCTTCAGGAACTACCTACACTCTCACTAGCGATGTTTCTATTACGAA
TGTATCTGCAATTACTCCTGCAGATAAAAGCTGTTTTACAAACACAGGAG
GAGCATTGAGTTTTGTTGGAGCTGATCACTCATTGGTTCTGCAAACCATA
GCGCTTACGCATGATGGTGCTGCAATTAACAATACCAACACAGCTCTTTC
TTTCTCAGGATTCTCGTCACTCTTAATCGACTCAGCTCCAGCAACAGGAA
CTTCGGGCGGCAAGGGTGCTATTTGTGTGACAAATACAGAGGGAGGTACT
GCGACTTTTACTGACAATGCCAGTGTCACCCTCCAAAAAAATACTTCAGA
AAAAGATGGAGCTGCAGTTTCTGCCTACAGCATCGATCTTGCTAAGACTA
CGACAGCAGCTCTCTTAGATCAAAATACTAGCACAAAAAATGGCGGGGCC
CTCTGTAGTACAGCAAACACTACAGTCCAAGGAAACTCAGGAACGGTGAC
CTTCTCCTCAAATACTGCTACAGATAAAGGTGGGGGGATCTACTCAAAAG
AAAAGGATAGCACGCTAGATGCCAATACAGGAGTCGTTACCTTCAAATCT
AATACTGCAAAGACGGGGGGTGCTTGGAGCTCTGATGACAATCTTGCTCT
TACCGGCAACACTCAAGTACTTTTTCAGGAAAATAAAACAACCGGCTCAG
CAGCACAGGCAAATAACCCGGAAGGTTGTGGTGGGGCAATCTGTTGTTAT
CTTGCTACAGCAACAGACAAAACTGGATTAGCCATTTCTCAGAATCAAGA
AATGAGCTTCACTAGTAATACAACAACTGCGAATGGTGGAGCGATCTACG
CTACTAAATGTACTCTGGATGGAAACACAACTCTTACCTTCGATCAGAAT
ACTGCGACAGCAGGATGTGGCGGAGCTATCTATACAGAAACTGAAGATTT
TTCTCTTAAGGGAAGTACGGGAACCGTGACCTTCAGCACAAATACAGCAA
AGACAGGCGGCGCCTTATATTCTAAAGGAAACAGCTCGCTGACTGGAAAT
ACCAACCTGCTCTTTTCAGGGAACAAAGCTACGGGCCCGAGTAATTCTTC
AGCAAATCAAGAGGGTTGCGGTGGGGCAATCCTAGCCTTTATTGATTCAG
GATCCGTAAGCGATAAAACAGGACTATCGATTGCAAACAACCAAGAAGTC
AGCCTCACTAGTAATGCTGCAACAGTAAGTGGTGGTGCGATCTATGCTAC
CAAATGTACTCTAACTGGAAACGGCTCCCTGACCTTTGACGGCAATACTG
CTGGAACTTCAGGAGGGGCGATCTATACAGAAACTGAAGATTTTACTCTT
ACAGGAAGTACAGGAACCGTGACCTTCAGCACAAATACAGCAAAGACAGG
CGGCGCCTTATATTCTAAAGGCAACAACTCTCTGTCTGGTAATACCAACC
TGCTCTTTTCAGGGAACAAAGCTACGGGCCCGAGTAATTCTTCAGCAAAT
CAAGAGGGTTGCGGTGGGGCAATCCTATCGTTTCTTGAGTCAGCATCTGT
AAGTACTAAAAAAGGACTCTGGATTGAAGATAACGAAAACGTGAGTCTCT
CTGGTAATACTGCAACAGTAAGTGGCGGTGCGATCTATGCGACCAAGTGT
GCTCTGCATGGAAACACGACTCTTACCTTTGATGGCAATACTGCCGAAAC
TGCAGGAGGAGCGATCTATACAGAAACCGAAGATTTTACTCTTACGGGAA
GTACGGGAACCGTGACCTTCAGCACAAATACAGCAAAGACAGCAGGGGCT
CTACATACTAAAGGAAATACTTCCTTTACCAAAAATAAGGCTCTTGTATT
TTCTGGAAATTCAGCAACAGCAACAGCAACAACAACTACAGATCAAGAAG
GTTGTGGTGGAGCGATCCTCTGTAATATCTCAGAGTCTGACATAGCTACA
AAAAGCTTAACTCTTACTGAAAATGAGAGTTTAAGTTTCATTAACAATAC
GGCAAAAAGAAGTGGTGGTGGTATTTATGCTCCTAAGTGTGTAATCTCAG
GCAGTGAATCCATAAACTTTGATGGCAATACTGCTGAAACTTCGGGAGGA
GCGATTTATTCGAAAAACCTTTCGATTACAGCTAACGGTCCTGTCTCCTT
TACCAATAATTCTGGAGGCAAGGGAGGCGCCATTTATATAGCCGATAGCG
GAGAACTTTCCTTAGAGGCTATTGATGGGGATATTACTTTCTCAGGGAAC
CGAGCGACTGAGGGAACTTCAACTCCCAACTCGATCCATTTAGGTGCAGG
GGCTAAGATCACTAAGCTTGCAGCAGCTCCTGGTCATACGATTTATTTTT
ATGATCCTATTACGATGGAAGCTCCTGCATCTGGAGGAACAATAGAGGAG
TTAGTCATCAATCCTGTTGTCAAAGCTATTGTTCCTCCTCCCCAACCAAA
AAATGGTCCTATAGCTTCAGTGCCTGTAGTCCCTGTAGCACCTGCAAACC
CAAACACGGGAACTATAGTATTTTCTTCTGGAAAACTCCCCAGTCAAGAT
GCCTCGATTCCTGCAAATACTACCACCATACTGAACCAGAAGATCAACTT
AGCAGGAGGAAATGTCGTTTTAAAAGAAGGAGCCACCCTACAAGTATATT
CCTTCACACAGCAGCCTGATTCTACAGTATTCATGGATGCAGGAACGACC
TTAGAGACCACGACAACTAACAATACAGATGGCAGCATCGATCTAAAGAA
TCTCTCTGTAAATCTGGATGCTTTAGATGGCAAGCGTATGATAACGATTG
CCGTAAACAGCACAAGTGGGGGATTAAAAATCTCAGGGGATCTGAAATTC
CATAACAATGAAGGAAGTTTCTATGACAATCCTGGGTTGAAAGCAAACTT
AAATCTTCCTTTCTTAGATCTTTCTTCTACTTCAGGAACTGTAAATTTAG
ACGACTTCAATCCGATTCCTTCTAGCATGGCTGCTCCGGATTATGGGTAT
CAAGGGAGTTGGACTCTGGTTCCTAAAGTAGGAGCTGGAGGGAAGGTGAC
TTTGGTCGCGGAATGGCAAGCGTTAGGATACACTCCTAAACCAGAGCTTC
GTGCGACTTTAGTTCCTAATAGCCTTTGGAATGCTTATGTAAACATCCAT
TCTATACAGCAGGAGATCGCCACTGCGATGTCGGACGCTCCCTCACATCC
AGGGATTTGGATTGGAGGTATTGGCAACGCCTTCCATCAAGACAAGCAAA
AGGAAAATGCAGGATTCCGTTTGATTTCCAGAGGTTATATTGTTGGTGGC
AGCATGACCACCCCTCAAGAATATACCTTTGCTGTTGCATTCAGCCAACT
CTTTGGCAAATCTAAGGATTACGTAGTCTCGGATATTAAATCTCAAGTCT
ATGCAGGATCTCTCTGTGCTCAGAGCTCTTATGTCATTCCCCTGCATAGC
TCATTACGTCGCCACGTCCTCTCTAAGGTCCTTCCAGAGCTCCCAGGAGA
AACTCCCCTTGTTCTCCATGGTCAAGTTTCCTATGGAAGAAACCACCATA
ATATGACGACAAAGCTTGCGAACAACACACAAGGGAAATCAGACTGGGAC
AGCCATAGCTTCGCTGTTGAAGTCGGTGGTTCTCTTCCTGTAGATCTAAA
CTACAGATACCTTACCAGCTACTCTCCCTATGTGAAACTCCAAGTTGTGA
GTGTAAATCAAAAAGGATTCCAAGAGGTTGCTGCTGATCCACGTATCTTT
GACGCTAGCCATCTGGTCAACGTGTCTATCCCTATGGGACTCACCTTCAA
ACACGAATCAGCAAAGCCCCCCAGTGCTTTGCTTCTTACTTTAGGTTACG
CTGTAGATGCTTACCGGGATCACCCTCACTGCCTGACCTCCTTAACAAAT
GGCACCTCGTGGTCTACGTTTGCTACAAACTTATCACGACAAGCTTTCTT
TGCTGAGGCTTCTGGACATCTGAAGTTACTTCATGGTCTTGACTGCTTCG
CTTCTGGAAGTTGTGAACTGCGCAGCTCCTCAAGAAGCTATAATGCAAAC
TGTGGAACTCGTTATTCTTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy