Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR349 IGR348 IGR350 IGR351 IGR352 IGR353 ycbF,trmU, - CPn0438 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 pmpG, - CPn0444 ycbF,trmU, - CPn0438 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 pmpG, - CPn0444 Type: tandem, Name:  - 7 ycbF,trmU, - CPn0438 CPn0442 CPn0440 CPn0441 CPn0443 pmpG, - CPn0444 CPn0439
* Calculated from Protein Sequence

Gene ID: CPn0443

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
488729

Gene Stop:
489982

Gene Length:
1254

Molecular Weight*:
45559

pI*:
10.90

Net Charge*:
26.69

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0443 is weakly similar to CT005, a hypothetical protein: residues 15-380 are 29% similar to CT005.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
417

PDB Hit:


Gene Protein Sequence:
MSQPPINPLGQPQVPAAASPSGQPSVVKRLKTSSTGLFKRFITIPDKYPK
MRYVYDTGIIALAAIAILSILLTASGNSLMLYALAPALALGALGVTLLIS
DILDSPKAKKIGEAITAIVVPIIVLAIAAGLIAGAFVASSGTMLVFANPM
FVMGLITVGLYFMSLNKLTLDYFRREHLLRMEKKTQETAEPILVTPSADD
AKKIAVEKKKDLSASARMEEHEASQRQDARHRRIGREAQGSFFYSSRNPE
HRRSFGSLSRFKTKPSDAASTRPASISPPFKDDFQPYHFKDLRSSSFGSG
ASSAFTPIMPASSRSPNFSTGTVLHPEPVYPKGGKEPSIPRVSSSSRRSP
RDRQDKQQQQQNQDEEQKQQSKKKSGKSNQSLKTPPPDGKSTANLSPSNP
FSDGYDEREKRKHRKNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCCAACCCCCTATAAACCCTTTAGGTCAACCTCAAGTTCCTGCAGC
AGCATCCCCATCAGGGCAGCCAAGCGTGGTAAAACGTTTAAAAACGTCAT
CCACAGGGTTATTCAAAAGATTTATTACTATTCCTGATAAATATCCTAAA
ATGCGCTATGTCTATGACACAGGCATTATTGCCCTTGCGGCAATTGCGAT
CCTTTCGATTCTCCTGACTGCTTCAGGAAACAGCCTTATGCTTTATGCTC
TCGCTCCGGCACTTGCCCTGGGAGCTTTGGGAGTTACTCTACTTATTTCT
GATATTCTGGACAGTCCGAAGGCCAAGAAAATCGGTGAGGCAATCACTGC
TATCGTCGTTCCTATCATTGTATTAGCGATTGCTGCGGGTCTTATTGCAG
GGGCTTTCGTTGCCTCTAGTGGGACGATGTTAGTCTTTGCCAACCCTATG
TTTGTCATGGGATTGATTACGGTGGGGCTATACTTCATGTCCTTGAATAA
GCTCACCTTAGATTATTTCCGTAGGGAACACCTCTTGAGGATGGAAAAGA
AAACCCAAGAGACCGCGGAGCCTATTCTAGTGACTCCATCCGCCGACGAT
GCAAAAAAAATCGCAGTGGAAAAGAAAAAAGATCTTTCTGCATCTGCCCG
CATGGAGGAACACGAAGCTTCACAACGCCAAGATGCCCGTCATCGTAGGA
TCGGTCGGGAGGCTCAAGGATCTTTCTTCTATTCGTCACGAAATCCTGAG
CATAGACGCTCCTTCGGCAGCCTCTCACGTTTTAAAACAAAACCCTCAGA
TGCGGCTTCTACACGACCCGCATCTATAAGTCCTCCATTTAAGGACGATT
TTCAGCCTTATCACTTCAAAGATTTAAGAAGCAGTTCATTCGGTAGTGGA
GCGAGCAGTGCGTTTACACCCATAATGCCTGCAAGTTCCCGCTCTCCTAA
TTTCTCCACGGGGACGGTTCTACACCCTGAGCCGGTCTACCCTAAGGGAG
GAAAAGAACCCTCAATTCCTCGAGTTTCTTCATCTTCCCGCCGTTCCCCT
CGTGATCGCCAAGATAAACAGCAGCAACAGCAAAATCAAGATGAAGAACA
GAAACAGCAATCTAAGAAGAAAAGCGGGAAATCGAATCAATCTCTTAAAA
CTCCGCCTCCAGACGGAAAAAGCACGGCTAACCTCAGCCCCTCCAATCCA
TTCTCTGACGGTTATGACGAAAGAGAAAAACGGAAACACAGAAAGAACAA
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy