Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR349 IGR348 IGR350 IGR351 IGR352 IGR353 ycbF,trmU, - CPn0438 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 ycbF,trmU, - CPn0438 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 Type: tandem, Name:  - 7 ycbF,trmU, - CPn0438 CPn0442 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 CPn0439
* Calculated from Protein Sequence

Gene ID: CPn0442

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
488013

Gene Stop:
488531

Gene Length:
519

Molecular Weight*:
18971

pI*:
10.00

Net Charge*:
7.75

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0442 is weakly similar to CT006, a hypothetical protein: residues 9-150 are 31% similar to that of CT006.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
43  
67
transmembrane  
90  
114
transmembrane  
119  
136

PDB Hit:


Gene Protein Sequence:
MGFKNICKQGSQLYLNGIFPERILARKLKNCAKSYPRTALTIEVLVSSVL
GALKVILIPCASTYAALTLPLRALFNAIKTKSCQHLASYAMAWLLHILTI
AVIIGLVFSLVFIPPPVVFISLGLLMSVTTSVTLFQVHKNLFPPYEPPPS
RPHTPPPFADEYVPLISESYFD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGATTCAAAAATATCTGCAAACAAGGCTCTCAGCTATACCTGAATGG
CATTTTTCCGGAACGAATACTAGCTCGAAAATTAAAAAACTGTGCGAAGA
GCTATCCCAGAACTGCTCTTACCATAGAAGTACTGGTATCCTCGGTCTTA
GGAGCTCTTAAGGTTATCCTGATCCCTTGCGCTTCTACATATGCTGCCTT
GACCCTACCCCTACGGGCTCTCTTTAACGCTATAAAAACAAAAAGCTGCC
AACATCTTGCTTCGTATGCTATGGCTTGGCTCCTCCACATTCTTACGATT
GCTGTGATTATCGGTCTGGTCTTTAGTCTGGTCTTTATCCCCCCTCCAGT
TGTCTTTATCTCCTTGGGGCTTCTCATGTCTGTAACTACTAGCGTTACCC
TCTTCCAAGTGCATAAAAATCTTTTCCCCCCGTATGAGCCTCCACCCTCA
CGACCTCACACGCCCCCTCCATTTGCTGATGAGTATGTCCCTCTCATAAG
CGAGTCTTATTTCGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy