Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR349 IGR348 IGR350 IGR351 IGR352 IGR347 IGR353 lplA, - CPn0436 ycbF,trmU, - CPn0438 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 lplA, - CPn0436 ycbF,trmU, - CPn0438 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 Type: tandem, Name:  - 7 lplA, - CPn0436 ycbF,trmU, - CPn0438 CPn0442 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 CPn0439
* Calculated from Protein Sequence

Gene ID: CPn0440

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
486105

Gene Stop:
486743

Gene Length:
639

Molecular Weight*:
23236

pI*:
10.10

Net Charge*:
9.00

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 55-106 are 50% similar to a defined domain of MERT_STAAU. This similarity corresponds to a weak E-value of 0.0015.

Paralogs:  Local Blast Search
No evidence of paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
57  
74
transmembrane  
79  
99
coil-coil  
146  
185

PDB Hit:


Gene Protein Sequence:
MATSVAPSPVPESSPLSHATEVLNLPNAYITQPHPIPAAPWETFRSKLST
KHTLCFALTLLLTLGGTISAGYAGYTGNWIICGIGLGIIVLTLILALLLA
IPLKNKQTGTKLIDEISQDISSIGSGFVQRYGLMFSTIKSVHLPELTTQN
QEKTRILNEIEAKKESIQNLELKITECQNKLAQKQPKRKSSQKSFMRSIK
HLSKNPVILFDC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAACTTCCGTAGCCCCATCACCAGTCCCCGAGAGCAGCCCTCTCTC
TCATGCTACAGAAGTTCTCAATCTTCCTAATGCTTATATTACGCAGCCTC
ATCCGATTCCAGCGGCTCCTTGGGAGACCTTTCGCTCCAAACTTTCCACA
AAGCATACGCTCTGTTTTGCCTTAACACTACTGTTAACCTTAGGGGGAAC
GATCTCAGCAGGTTACGCAGGATATACTGGAAACTGGATCATCTGTGGCA
TCGGCTTGGGAATTATCGTACTCACACTGATTCTTGCTCTTCTTCTAGCA
ATCCCTCTTAAAAATAAGCAGACAGGAACAAAACTGATTGATGAGATATC
TCAAGACATTTCCTCTATAGGATCAGGATTTGTTCAGAGATACGGGTTGA
TGTTCTCTACAATTAAAAGCGTGCATCTTCCAGAGCTGACAACACAAAAT
CAAGAAAAAACAAGAATTTTAAATGAAATTGAAGCGAAAAAGGAATCGAT
CCAAAATCTTGAGCTTAAAATTACTGAGTGCCAAAACAAGTTAGCACAGA
AACAGCCGAAACGGAAATCATCTCAGAAATCATTTATGCGTAGTATTAAG
CACCTCTCCAAGAACCCTGTAATTTTGTTCGATTGCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy