Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR349 IGR348 IGR350 IGR351 IGR352 IGR347 IGR353 ycbF,trmU, - CPn0438 CPn0435 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 ycbF,trmU, - CPn0438 CPn0435 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 ycbF,trmU, - CPn0438 lplA, - CPn0436 CPn0435 lplA, - CPn0436 CPn0442 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 pmpG, - CPn0444 CPn0439
* Calculated from Protein Sequence

Gene ID: CPn0439

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
485553

Gene Stop:
486080

Gene Length:
528

Molecular Weight*:
19508

pI*:
8.20

Net Charge*:
2.76

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 75 to 175 (E-value = 6.9e-25) place CPn0439 in the DUF710 family which is described as Family of unknown function (DUF710) (PF05164)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
43  
67
transmembrane  
72  
95

PDB Hit:


Gene Protein Sequence:
VSSTLNGVFPSSLPEESADLFITNKEIVALGEKGNVFLTHSIPMHIAAIT
ILVIVALAGIAIICLGCYSQSILLIAVGIVLTILTLLCLQALVGFIKFIR
QLPQQLHTTVQFIREKIRPESSLQLVTNAQRKTTQDTLKLYEELCDLSQK
EFKLQSTLYQKRFELSHKNEKTNQN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCTAGTACTTTAAACGGGGTATTTCCCTCATCCCTTCCGGAAGAGTC
TGCTGATTTATTCATTACGAATAAGGAGATCGTAGCTTTGGGGGAGAAGG
GCAATGTTTTTCTCACCCACTCCATTCCTATGCATATTGCTGCGATTACG
ATCTTAGTGATTGTAGCTCTTGCTGGAATCGCTATTATCTGTTTGGGTTG
CTATAGCCAAAGCATTCTGTTGATTGCCGTTGGCATTGTTCTTACTATTT
TGACTCTTCTCTGCCTACAAGCCTTGGTAGGATTTATTAAATTCATCCGG
CAGCTCCCTCAGCAGCTCCATACGACAGTACAATTTATCAGGGAGAAGAT
TCGACCTGAATCCTCTCTACAGCTTGTAACCAATGCACAGAGAAAAACCA
CTCAAGATACGCTAAAGTTATACGAAGAACTCTGCGACCTCTCACAAAAA
GAGTTCAAACTGCAATCAACTCTTTATCAAAAACGTTTTGAGCTTTCTCA
CAAGAATGAAAAGACAAATCAAAACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy