Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR349 IGR348 IGR350 IGR351 IGR352 IGR347 ycbF,trmU, - CPn0438 CPn0435 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 ycbF,trmU, - CPn0438 CPn0435 CPn0442 CPn0439 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 ycbF,trmU, - CPn0438 CPn0435 lplA, - CPn0436 lplA, - CPn0436 CPn0442 CPn0440 CPn0441 CPn0443 ClpC, - CPn0437 CPn0439
* Calculated from Protein Sequence

Gene ID: CPn0438

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ycbF  trmU  

Definition:
probable tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferase, TrmU or PP-loop superfamily ATPase

Gene Start:
485416

Gene Stop:
484331

Gene Length:
1086

Molecular Weight*:
40643

pI*:
6.30

Net Charge*:
-3.05

EC:
 

Functional Class:
translation; tRNA and rRNA base modification  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0438 is orthologously related to CT287: residues 1-357 of CPn0438 are 70% similar to residues 1-355 of CT287, a probable tRNA-(5-methylaminomethyl-2-thiouridylate) methyltransferase, trmU from C. trachomatis.
CPn0438 is also similar to UU402 and MG295, both hypothetical proteins.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0482
COG name: Predicted ATPase of the PP-family
Functional Class:  R
The phylogenetic pattern of COG0482 is ----yQvcebrhUJgpo-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 352 (E-value = 3.9e-220) place CPn0438 in the tRNA_Me_trans family which is described as tRNA methyl transferase (PF03054)
Residues 4 to 224 (E-value = 2.2e-05) place CPn0438 in the ATP_bind_3 family which is described as PP-loop family (PF01171)

PDB Hit:


Gene Protein Sequence:
MQQTVIVAMSGGVDSSVVAYLFKKFTNYKVIGLFMKNWEEDSEGGLCSST
KDYEDVERVCLQLDIPYYTVSFAKEYRERVFARFLKEYSLGYTPNPDILC
NREIKFDLLQKKVQELGGDYLATGHYCRLNTELQETQLLRGCDPQKDQSY
FLSGTPKSALHNVLFPLGEMNKTEVRAIAAQAALPTAEKKDSTGICFIGK
RPFKEFLEKFLPNKTGNVIDWDTKEIVGQHQGAHYYTIGQRRGLDLGGSE
KPCYVVGKNIEENSIYIVRGEDHPQLYLRELTARELNWFTPPKSGCHCSA
KVRYRSPDEACTIDYSSGDEVKVRFSQPVKAVTPGQTIAFYQGDTCLGSG
VIDVPMIPSEG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACAAACTGTAATTGTAGCAATGTCAGGAGGCGTGGATTCTTCTGT
CGTTGCCTATTTATTCAAAAAATTTACCAATTATAAGGTTATTGGCCTCT
TCATGAAGAATTGGGAAGAGGATAGCGAAGGCGGCCTTTGCTCGTCTACT
AAAGATTATGAAGATGTCGAGAGGGTATGTCTTCAGCTCGATATCCCTTA
TTACACCGTATCTTTTGCTAAAGAATATAGAGAAAGAGTGTTCGCTCGTT
TCCTCAAGGAATACTCTTTAGGCTACACTCCTAACCCCGACATTCTTTGT
AACCGAGAAATCAAATTTGACCTTCTACAAAAGAAAGTCCAGGAACTTGG
CGGAGATTACCTCGCTACAGGGCACTACTGCCGATTAAATACCGAGCTCC
AAGAAACCCAACTCCTTAGAGGTTGCGATCCTCAAAAAGATCAGAGCTAT
TTTTTATCAGGAACTCCTAAAAGTGCTCTTCACAATGTGCTCTTTCCTCT
TGGGGAAATGAATAAGACTGAAGTTCGTGCGATTGCAGCTCAAGCAGCTC
TTCCCACAGCAGAAAAAAAAGATAGTACAGGCATTTGCTTTATAGGGAAG
CGCCCTTTTAAAGAGTTCCTAGAGAAGTTTCTTCCCAATAAAACAGGCAA
CGTTATCGATTGGGATACCAAGGAAATTGTAGGGCAACATCAGGGAGCTC
ACTATTATACTATAGGGCAGCGGCGAGGACTTGATCTTGGAGGATCCGAG
AAACCCTGTTATGTTGTGGGAAAAAATATAGAGGAAAATAGCATTTATAT
TGTGAGGGGGGAAGACCATCCCCAGCTCTACCTACGGGAATTAACAGCTA
GAGAGCTCAATTGGTTTACCCCTCCTAAATCCGGATGTCACTGTAGCGCT
AAAGTCCGCTACCGTTCTCCTGATGAAGCTTGCACGATAGATTATAGCTC
AGGTGACGAGGTCAAGGTGCGATTTTCACAACCCGTCAAGGCGGTAACTC
CAGGACAAACAATAGCGTTTTATCAAGGAGATACCTGCCTTGGTAGTGGA
GTTATCGACGTTCCTATGATTCCAAGTGAGGGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy