Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR346 IGR349 IGR344 IGR345 IGR348 IGR347 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 ycbF,trmU, - CPn0438 CPn0435 CPn0434 CPn0439 CPn0440 ClpC, - CPn0437 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 ycbF,trmU, - CPn0438 CPn0435 CPn0434 CPn0439 CPn0440 ClpC, - CPn0437 gcvT,gcsH, - CPn0433 ycbF,trmU, - CPn0438 CPn0435 CPn0434 lplA, - CPn0436 lplA, - CPn0436 CPn0431 CPn0432 CPn0440 ClpC, - CPn0437 CPn0439
* Calculated from Protein Sequence

Gene ID: CPn0436

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lplA  

Definition:
lipoate-protein ligase

Gene Start:
481618

Gene Stop:
480899

Gene Length:
720

Molecular Weight*:
26662

pI*:
5.90

Net Charge*:
-5.21

EC:
 

Functional Class:
protein fate; protein modification and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum sequences.

CPn0436 is orthologously related to CT285 and
they share 53% similarity.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0095
COG name: Lipoate-protein ligase A
Functional Class:  H
The phylogenetic pattern of COG0095 is ---kyQvceB----gp--IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 47 to 184 (E-value = 1.9e-27) place CPn0436 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
212  
239

PDB Hit:


Gene Protein Sequence:
MKVRIVDSGKSSAASHMAKDRDLLESLQDGELILHLYEWENPCSLTYGHF
MRPEKFLLSNYADLGLDAAVRPTGGGFVFHKGDYAFSVLMSATHPSYSSS
VLENYHTVNSFVAKVLEKVFRIQGMLAPEDENSSSRDSGNFCMAKTSKYD
VLFGDKKIGGAAQRKVQQGFLHQGSLFLSGSSSEFYQRFLKPEVLEEIIE
QIQIHAFFPLGLEAADEVLQEARQQVKEAFIKLFCGEGL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTTCGTATCGTAGATTCAGGAAAATCTTCAGCGGCCTCCCACAT
GGCTAAGGACAGAGATTTATTAGAATCTCTGCAAGATGGGGAGCTCATTT
TACACCTTTATGAGTGGGAGAATCCTTGTTCTCTGACGTACGGTCACTTT
ATGCGTCCAGAAAAATTTTTACTTTCCAACTATGCGGATCTAGGATTGGA
CGCCGCAGTGCGGCCTACGGGAGGGGGATTTGTCTTCCATAAGGGAGATT
ATGCTTTTTCTGTTCTTATGTCTGCGACACATCCTTCCTATTCTTCTTCG
GTACTTGAGAACTACCATACTGTAAACTCTTTTGTAGCGAAGGTTCTAGA
GAAAGTATTTCGGATCCAGGGAATGTTAGCTCCAGAAGACGAAAACTCTT
CTTCCAGAGATTCAGGAAATTTTTGTATGGCAAAAACTTCGAAGTATGAC
GTTCTTTTTGGGGACAAGAAGATAGGGGGCGCTGCCCAACGCAAGGTGCA
ACAGGGATTTTTACATCAAGGATCCTTATTCTTATCGGGAAGTTCTTCTG
AGTTTTACCAGAGATTTTTAAAACCCGAGGTTCTTGAAGAAATTATTGAA
CAAATCCAGATTCACGCGTTTTTCCCTTTAGGTTTGGAAGCTGCTGATGA
AGTGCTGCAGGAGGCGCGTCAGCAAGTCAAAGAGGCGTTTATTAAATTGT
TTTGTGGTGAGGGGTTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy