Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR342 IGR346 IGR344 IGR343 IGR345 IGR347 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 ycbF,trmU, - CPn0438 CPn0435 CPn0434 nqr4, - CPn0429 nqr5, - CPn0430 ClpC, - CPn0437 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 ycbF,trmU, - CPn0438 CPn0435 CPn0434 nqr4, - CPn0429 nqr5, - CPn0430 ClpC, - CPn0437 CPn0431 gcvT,gcsH, - CPn0433 ycbF,trmU, - CPn0438 CPn0435 CPn0434 lplA, - CPn0436 lplA, - CPn0436 CPn0432 nqr5, - CPn0430 ClpC, - CPn0437 nqr4, - CPn0429
* Calculated from Protein Sequence

Gene ID: CPn0435

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible phospholipase D HKD-related protein)

Gene Start:
480902

Gene Stop:
479472

Gene Length:
1431

Molecular Weight*:
54459

pI*:
6.40

Net Charge*:
-6.68

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
See CPn0329, a second predicted phospholipase D HKD-related protein in C. pneumoniae.

Blast Summary:  PSI-Blast Search
CPn0435 is orthologously related to CT284: residues 9-476 of CPn0435 are 42% similar to residues 6-474 of CT284, a predicted conserved hypothetical protein (possible phospholipase D HKD-related
protein) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1502
COG name: Cardiolipin synthase, phoaphatidylserine synthase and related enzymes of the phospholipase D family
Functional Class:  I
The phylogenetic pattern of COG1502 is a---y-vcEB-hUJ----INx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
26

PDB Hit:


Gene Protein Sequence:
MMSRLRFRLAALGIFFILLVPNSVSAKTIVASDKEKVGVLVYDNSVEAFQ
QILDCIDHANFYVELCPCMTGGRTLKEMVDHLEARMDLVPELCSYIIIQP
TFTDAEDQKLLKALKERHPNRFFYVFTGCPPSTSILAPNVIEMHIKLSII
DGKYCILGGTNFEEFMCTPGDEVPEKVDNPRLFVSGVRRPLAFRDQDIML
RSTAFGLQLREEYHKQFAMWDYYAHHMWFIDNPEQFAGACPPLTLEQAEE
TVFPGFDKHEDLVLVDSSKIRIVLGGPHDKQPNPVTQEYLKLIQGARSSV
KLAHMYFIPKDELLNALVDVSHNHGVHLSLITNGCHELSPAITGPYAWGN
RINYFALLYGKRYPLWKKWFCEKLKPYERVSIYEFAIWETQLHKKCMIID
DEIFVIGSYNFGKKSDAFDYESIVVIESPEVAAKANKVFNKDIGLSIPVS
HGDIFSWYFHSVHHTLGHLQLTYMPA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAGTCGGTTGCGTTTTCGCTTGGCAGCTCTTGGAATATTTTTTAT
TTTGCTGGTTCCTAATTCTGTTTCAGCAAAGACAATCGTAGCTTCAGACA
AGGAGAAGGTTGGAGTTCTTGTTTATGACAATAGTGTAGAGGCCTTTCAA
CAGATATTGGATTGCATAGATCATGCAAATTTTTATGTAGAACTGTGTCC
CTGCATGACAGGAGGCCGAACGCTTAAAGAGATGGTAGATCACCTCGAGG
CTCGTATGGATCTGGTTCCAGAGCTCTGTAGCTATATCATTATCCAACCC
ACGTTTACCGATGCTGAAGACCAAAAATTACTCAAAGCTCTCAAAGAACG
TCATCCCAACCGGTTTTTCTACGTTTTTACAGGGTGCCCACCCTCAACAA
GCATCCTCGCTCCTAATGTCATTGAAATGCATATCAAACTTTCTATCATC
GATGGGAAATATTGTATTTTAGGTGGTACCAATTTTGAAGAGTTTATGTG
CACTCCAGGGGATGAGGTTCCTGAGAAAGTGGATAACCCACGTTTATTTG
TCAGTGGAGTGCGTCGGCCCCTAGCATTTCGTGATCAGGATATCATGTTG
CGTTCTACAGCATTCGGTTTGCAGCTCAGAGAAGAATATCATAAGCAATT
TGCTATGTGGGACTACTATGCACATCATATGTGGTTCATTGATAATCCTG
AACAGTTTGCAGGCGCCTGTCCTCCACTGACTTTAGAACAAGCCGAGGAG
ACAGTATTTCCTGGATTTGACAAACATGAAGATCTTGTTCTTGTCGACTC
TTCCAAGATCAGGATAGTTTTAGGTGGTCCCCACGATAAGCAACCCAATC
CTGTGACTCAAGAATATTTGAAACTTATCCAGGGAGCTAGATCTTCTGTG
AAGCTTGCTCACATGTATTTCATCCCTAAGGACGAGCTTTTAAATGCTCT
TGTCGACGTTTCTCATAATCACGGTGTTCATCTGAGTTTAATTACGAACG
GCTGTCATGAATTAAGTCCTGCAATTACAGGACCCTATGCTTGGGGAAAC
CGTATTAACTATTTCGCCTTGCTCTATGGGAAACGGTATCCTCTTTGGAA
AAAATGGTTTTGCGAAAAGCTAAAACCTTATGAGCGGGTTTCTATTTATG
AGTTTGCTATTTGGGAAACGCAGTTGCACAAGAAGTGTATGATTATCGAT
GATGAAATTTTTGTGATCGGAAGTTATAATTTTGGAAAGAAAAGTGATGC
CTTTGATTACGAAAGTATTGTAGTTATCGAATCTCCAGAAGTCGCTGCAA
AAGCTAACAAAGTCTTCAATAAAGATATCGGATTGTCGATTCCTGTAAGT
CATGGCGACATTTTCTCTTGGTATTTCCATTCCGTACACCACACTTTGGG
ACATTTGCAGCTGACCTATATGCCAGCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy