Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR342 IGR341 IGR346 IGR344 IGR343 IGR345 IGR347 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0435 CPn0434 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 ClpC, - CPn0437 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0435 CPn0434 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 ClpC, - CPn0437 CPn0431 gcvT,gcsH, - CPn0433 CPn0435 CPn0434 lplA, - CPn0436 lplA, - CPn0436 CPn0432 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 ClpC, - CPn0437 nqr4, - CPn0429 nqr4, - CPn0429
* Calculated from Protein Sequence

Gene ID: CPn0434

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
479462

Gene Stop:
477273

Gene Length:
2190

Molecular Weight*:
85267

pI*:
9.40

Net Charge*:
13.83

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0434 is orthologously related to CT283, a hypothetical protein: residues 38-720 are 51% similar to CT283.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
89
non-globular  
498  
567

PDB Hit:


Gene Protein Sequence:
VRIYQQDLFCRLCRDPAWFFSLLSFTLRFYCLGRGWTLLSFFYKHQKKFI
GIVIAVVCVSGIGVGWGRFSRKGSAESTSRRTVFTTASGKRYVEKDFMAM
KKFFAHEAYPFTGNPRAWNFINEGLLTDYFLTTRVGEKLFLKVYHPGEKI
FSKEKAYQPYRRFDAPFISSEEVWKSSAPQLLEILKVFQQIENPISKEGF
LARAKLFLEERRFPHYVLRQMLEYRRQMFALPPDEALSRGKDLRLFGYQT
IQDWFGDAYLSAAVELLIRFIDEQKKVLPRPSKQEARDDFYDKAKHAYTK
ISKNKEFSLGFEEFVNSYFQFLEISESEFFNMYRDILLCKRALLLLQGGV
SFDFQPLTTFFVQGKDSIQVEFFRLPKEYSFKTKQELKAFEVYLKLVSLP
KSDSLDVPNEILPIATIKAKEPRLVGRRFSIDYKRVALQDLAATVPMVEV
LHWQQNSEHFQEILQQFPDVETCQSYKDFQHLKPALRDKISLFTRKEILR
ARPERILQSLQQVPKQSQEVLLSAGKNSALPGISDGQQLAKVLLENEVLD
LYSQDAETYYTIIVNSSFEKEEVLPYREVLKRDLASQLLTSHGHLVDMER
LESALRTRYPGEEGASLWQRRLWKVVENHRLGRHLEGSFSWSLDRSLKTF
SRGDKELPQEFDRIFSMKVGDYSSVFMSPNEGPCYYQCLSHLLYDRPASV
DKLFLAKSQLDEELLGSYMERFIEQGVVR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGAATCTACCAACAGGATCTCTTCTGCAGGCTCTGCAGGGATCCTGC
CTGGTTTTTTTCTCTGCTATCGTTTACACTACGCTTTTATTGTTTGGGTA
GAGGGTGGACCTTGTTATCGTTCTTCTATAAGCATCAAAAAAAATTTATC
GGCATTGTCATTGCTGTAGTTTGTGTTTCTGGTATTGGAGTGGGTTGGGG
ACGATTCTCTAGAAAAGGTTCTGCAGAGTCCACCTCACGTCGGACTGTTT
TTACTACCGCTTCAGGGAAGCGGTATGTAGAGAAAGATTTCATGGCTATG
AAGAAGTTCTTTGCTCACGAAGCGTATCCATTTACAGGGAACCCTAGAGC
TTGGAATTTTATCAATGAGGGGCTACTTACTGATTATTTTCTAACGACAA
GGGTGGGAGAAAAACTCTTTTTAAAAGTGTACCATCCGGGAGAGAAAATT
TTTAGTAAGGAGAAAGCTTACCAGCCGTATCGTCGTTTTGACGCTCCTTT
TATTTCCTCTGAAGAAGTTTGGAAATCTTCAGCTCCCCAGCTTTTAGAGA
TCCTGAAGGTCTTTCAACAAATCGAGAACCCCATATCAAAAGAAGGATTT
CTTGCTAGAGCCAAGCTCTTTTTAGAAGAGAGAAGGTTCCCTCATTATGT
GCTTCGACAAATGTTGGAGTACCGCAGGCAAATGTTTGCTCTTCCCCCAG
ATGAAGCCTTATCTCGCGGGAAAGACTTGCGGTTATTTGGCTACCAGACG
ATTCAAGACTGGTTTGGGGATGCCTACCTTTCTGCTGCTGTTGAGCTCTT
GATCCGCTTTATTGACGAGCAGAAAAAAGTACTTCCCAGGCCCTCAAAAC
AAGAAGCTCGTGACGACTTTTATGATAAGGCGAAGCATGCCTATACTAAG
ATCAGTAAGAATAAGGAATTTTCCTTAGGATTTGAAGAATTTGTAAACTC
GTATTTTCAGTTTTTAGAGATCTCTGAGTCCGAATTTTTCAATATGTATC
GAGACATATTGTTGTGCAAAAGAGCTCTTCTCCTATTGCAGGGAGGCGTT
TCTTTTGACTTCCAACCTCTAACTACATTTTTCGTTCAAGGAAAAGATTC
CATACAAGTAGAGTTCTTTAGACTCCCTAAGGAGTATAGCTTTAAAACAA
AACAAGAGTTAAAAGCTTTCGAAGTCTATTTAAAGTTAGTGAGTTTACCT
AAATCGGATAGTTTGGATGTTCCTAATGAGATCCTTCCTATAGCGACCAT
AAAAGCTAAAGAGCCTCGGTTAGTAGGCAGACGGTTTTCTATAGACTATA
AGAGAGTCGCTTTGCAAGACTTAGCAGCTACTGTACCTATGGTTGAAGTG
CTGCACTGGCAACAAAATTCTGAGCACTTCCAGGAGATTCTCCAGCAGTT
TCCTGACGTTGAGACGTGTCAGTCGTATAAAGACTTCCAACATCTTAAGC
CTGCGCTGCGAGATAAAATTTCTCTTTTCACACGCAAGGAAATCTTAAGG
GCCCGCCCTGAGAGAATTCTGCAATCGCTACAGCAAGTTCCTAAGCAGAG
CCAAGAAGTTCTCTTATCTGCAGGGAAGAATAGTGCTCTACCAGGAATAT
CCGACGGTCAGCAATTAGCCAAAGTGTTGCTTGAAAACGAGGTTTTAGAT
TTATATAGCCAGGATGCAGAGACCTATTATACTATTATTGTTAATAGTTC
TTTTGAAAAAGAAGAAGTGCTTCCTTATCGTGAGGTTTTAAAGAGAGATT
TGGCCTCACAGTTACTTACTTCTCATGGTCATCTTGTTGACATGGAGCGT
CTAGAATCTGCGTTGCGTACACGGTATCCAGGAGAAGAAGGCGCTAGCCT
ATGGCAACGACGTCTTTGGAAGGTAGTGGAAAACCACAGATTGGGAAGGC
ATCTCGAGGGGTCTTTCTCTTGGAGCTTAGATCGCTCATTGAAGACTTTT
TCCCGAGGAGACAAGGAGCTGCCCCAAGAGTTTGATAGGATTTTCTCTAT
GAAGGTAGGAGACTATTCTTCTGTATTCATGAGTCCTAACGAAGGGCCCT
GTTATTATCAATGCCTCTCTCATTTACTGTATGATCGTCCTGCTAGCGTG
GATAAACTATTTTTAGCTAAAAGTCAGCTAGATGAAGAACTTTTAGGATC
CTATATGGAACGCTTTATAGAACAGGGAGTCGTAAGGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy