Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR342 IGR341 IGR346 IGR344 IGR343 IGR340 IGR345 IGR347 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 ClpC, - CPn0437 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 ClpC, - CPn0437 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 lplA, - CPn0436 lplA, - CPn0436 CPn0432 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 ClpC, - CPn0437 nqr4, - CPn0429 nqr4, - CPn0429
* Calculated from Protein Sequence

Gene ID: CPn0433

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcvT  gcsH  

Definition:
glycine cleavage system H protein

Gene Start:
477273

Gene Stop:
476926

Gene Length:
348

Molecular Weight*:
12859

pI*:
4.20

Net Charge*:
-12.33

EC:
 

Functional Class:
amino acid biosynthesis; serine-glycine family  

Pathway: pathway table

Comment:
This enzyme typically resides in mitochondria and is
responsible for the degradation of glycine. In E.coli, the cleavage system
is constituted from P,T,L, and H components, with the H protein conveying
the methylamine group of glycine from the P to the T proteins.

Blast Summary:  PSI-Blast Search
Cpn0433 is similar to CT282, a predicted gcsH/gcvT glycine cleavage H protein. Residues 2-111 are 58% similar to CT282.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0509
COG name: Glycine cleavage system H protein (lipoate-binding)
Functional Class:  E
The phylogenetic pattern of COG0509 is ---kyQvcebr-------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 115 (E-value = 2.2e-18) place CPn0433 in the GCV_H family which is described as Glycine cleavage H-protein (PF01597)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
115

PDB Hit:


Gene Protein Sequence:
MWYSDYHVWILPVHERVVRLGLTEKMQKNLGAILHVDLPSVGSLCKEGEV
LVILESSKSAIEVLSPVSGEVIDINLDLVDNPQKINEAPEGEGWLAVVRL
DQDWDPSNLSLMDEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGTATTCTGATTATCATGTTTGGATTTTGCCCGTCCATGAGAGGGT
GGTGCGCCTCGGGTTAACAGAAAAAATGCAGAAAAATTTAGGAGCCATTC
TCCATGTGGATTTACCTTCAGTAGGGAGTCTATGTAAAGAAGGTGAGGTT
TTAGTCATTCTGGAATCTTCTAAATCTGCTATAGAGGTGTTAAGTCCTGT
ATCAGGAGAGGTTATCGATATCAACCTTGATTTAGTGGATAATCCTCAGA
AGATTAACGAAGCTCCAGAAGGTGAGGGATGGTTGGCTGTAGTCCGACTA
GACCAGGACTGGGATCCTTCTAATCTTTCTTTGATGGATGAAGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy