Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR342 IGR341 IGR346 IGR344 IGR343 IGR340 IGR345 IGR347 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 lplA, - CPn0436 lplA, - CPn0436 CPn0432 nqr5, - CPn0430 nqr3, - CPn0428 nqr2, - CPn0427 nqr4, - CPn0429 nqr4, - CPn0429
* Calculated from Protein Sequence

Gene ID: CPn0432

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
476816

Gene Stop:
476511

Gene Length:
306

Molecular Weight*:
10718

pI*:
7.80

Net Charge*:
1.51

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other knwon sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
37  
54
transmembrane  
59  
81

PDB Hit:


Gene Protein Sequence:
MDPASPVAPHVLQDHVQLSSEELSALSSGVSRVKKLTIAIMVLSLIAISL
VACGLFLTGSAPLQLSIWIAASCITLSMLVCACWRYKISNALEKTKVAHE
S$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCCAGCTAGTCCGGTAGCCCCTCATGTCCTACAAGATCATGTGCA
ACTATCTTCTGAAGAATTGTCCGCATTATCTTCCGGGGTATCTCGTGTGA
AGAAGCTTACTATAGCCATCATGGTCCTTTCATTGATAGCGATTTCTTTG
GTAGCCTGTGGCCTATTTTTAACGGGATCGGCACCTCTACAGCTCTCGAT
CTGGATTGCTGCGAGTTGCATTACCTTATCTATGTTAGTTTGTGCGTGTT
GGCGTTATAAGATTTCCAATGCCTTAGAAAAAACTAAGGTAGCGCATGAA
AGCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy