Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR342 IGR341 IGR346 IGR339 IGR344 IGR343 IGR340 IGR345 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 CPn0432 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 nqr4, - CPn0429 nqr4, - CPn0429 CPn0425
* Calculated from Protein Sequence

Gene ID: CPn0430

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqr5  

Definition:
Na+-translocating NADH-quinone reductase

Gene Start:
475326

Gene Stop:
476096

Gene Length:
771

Molecular Weight*:
27778

pI*:
10.00

Net Charge*:
7.28

EC:
1.6.5.3  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and OtherSubstances; Ubiquinone biosynthesi

Comment:


Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to
M. genitalium, T. pallidum and U. urealyticum.

CPn0430 is orthologously related to CT281:
residues 1-241 are 73% similar to residues 1-239 of CT281. CPn0430 is also similar to CT280:
residues 18-182 are 25% similar to residues
14-160 of CT280.

COGS Summary:  COGS Search
BeTs to 3 clades of COG2209
COG name: Na+-translocating NADH-quinone oxidoreductase, subunit 5 (NqrE)
Functional Class:  C
The phylogenetic pattern of COG2209 is ------v-e--H------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
residues 23-182 are 23% similar to residues
19-160 of CPn0429, a predicated NADH-quinone reductase 4 (nqr4).


Pfam Summary:  Pfam Search
Residues 8 to 211 (E-value = 2.2e-92) place CPn0430 in the Rnf-Nqr family which is described as Rnf-Nqr subunit, membrane protein (PF02508)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
12  
34
transmembrane  
50  
74
transmembrane  
84  
105
transmembrane  
123  
140
transmembrane  
145  
169
transmembrane  
191  
208

PDB Hit:


Gene Protein Sequence:
MWLGAYTWLNVFGILLQAAFIQNILLANFLGMCSYLACSTRVSTANGLGM
SVALVLTVTGSINWFVHAFITGPKALTWISPSLASVNLGFLELIIFIVVI
AAFTQILELLLEKVSRNLYLSLGIFLPLIAVNCAILGGVLFGITRSYPFI
PMMIFSLGAGCGWWLAIVILATIKEKLAYSDIPKNLQGMGISFITTGLIA
MAFMSLTGIDISKPSAKIQRAPLETEVVENTTNPLKESSSKHQPSISKAR
TQRRSL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGTTAGGTGCGTATACTTGGCTTAATGTCTTTGGTATTCTTCTACA
AGCAGCCTTTATTCAGAATATCCTTCTTGCGAATTTCTTGGGGATGTGTA
GTTACCTTGCTTGCTCTACTAGGGTTTCTACAGCCAATGGCTTGGGGATG
TCCGTAGCCCTTGTTCTCACTGTAACAGGGAGCATCAACTGGTTTGTCCA
TGCTTTCATCACGGGCCCTAAAGCTCTAACTTGGATCTCTCCATCTTTAG
CTTCTGTAAACCTAGGTTTTCTGGAGCTGATTATTTTCATCGTGGTGATT
GCGGCATTCACGCAAATCTTAGAGCTTCTTTTAGAAAAGGTCTCCAGGAA
TCTATATCTCTCCTTAGGGATCTTCCTTCCCTTGATTGCTGTGAACTGCG
CGATCCTAGGGGGTGTGCTCTTCGGAATCACACGTAGTTATCCTTTTATT
CCTATGATGATCTTCTCTTTAGGAGCGGGATGTGGGTGGTGGCTCGCTAT
TGTTATTTTAGCCACTATCAAAGAAAAACTCGCCTACTCTGATATTCCCA
AAAACCTCCAGGGAATGGGGATCTCCTTCATTACAACAGGCCTCATTGCT
ATGGCTTTTATGAGCTTAACAGGTATTGATATTTCTAAACCTTCAGCAAA
GATTCAAAGAGCTCCTCTAGAGACTGAAGTTGTTGAAAACACGACCAATC
CACTAAAAGAATCTTCGTCCAAACACCAGCCAAGTATTTCTAAAGCACGA
ACGCAGCGTCGCTCTCTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy