Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR342 IGR341 IGR346 IGR339 IGR344 IGR343 IGR340 IGR345 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0435 CPn0434 CPn0432 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 nqr4, - CPn0429 nqr4, - CPn0429
* Calculated from Protein Sequence

Gene ID: CPn0429

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqr4  

Definition:
Na+-translocating NADH-quinone reductase

Gene Start:
474681

Gene Stop:
475322

Gene Length:
642

Molecular Weight*:
23642

pI*:
10.40

Net Charge*:
8.32

EC:
1.6.5.3  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to
M. genitalium, T. pallidum and U. urealyticum.

CPn0429 is orthologously related to CT280 and
they share 79% similarity.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1347
COG name: Na+-translocating NADH-quinone reductase, subunit 5
Functional Class:  C
The phylogenetic pattern of COG1347 is ------v-e--H------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0429 is similar to CPn0430, a predicated NADH-quinone reductase 5 (nqr5): residues 19-160 are 23% similar to CPn0430.

Pfam Summary:  Pfam Search
Residues 4 to 201 (E-value = 2.2e-112) place CPn0429 in the Rnf-Nqr family which is described as Rnf-Nqr subunit, membrane protein (PF02508)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
22  
46
transmembrane  
51  
68
transmembrane  
74  
95
transmembrane  
100  
117
transmembrane  
137  
156
transmembrane  
186  
203

PDB Hit:


Gene Protein Sequence:
MTSKKSYKSYFFDPLWSNNQILIAILGICSALAVTTTVQTAITMGIAVSI
VTGCSSFFVSLLRKFTPDSVRMITQLIIISLFVIVIDQFLKAFFFDISKT
LSVFVGLIITNCIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIGV
IRELFGFGTLMGFRIIPQFVYASETHPDGYQNLSLMVLAPSAFFLLGIMI
WLVNIRDSKKRKR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAGTAAAAAGTCCTATAAAAGCTATTTCTTTGATCCTCTATGGAG
CAACAACCAAATTCTCATTGCGATTTTGGGGATTTGCTCGGCTCTGGCAG
TGACAACAACAGTACAAACGGCAATTACTATGGGAATTGCTGTCAGCATT
GTTACAGGATGCTCGTCTTTCTTTGTTTCCTTATTACGTAAGTTCACTCC
TGACAGTGTGAGAATGATTACTCAGCTAATTATCATTAGCTTGTTTGTGA
TTGTTATCGACCAGTTTTTAAAAGCTTTTTTCTTTGATATTTCCAAAACA
CTTTCTGTTTTTGTGGGTCTTATCATCACCAATTGCATCGTGATGGGAAG
GTCTGAAAGTCTAGCTAGGCATGTGACTCCTATTCCAGCGTTCTTAGATG
GGTTTGCCTCTGGCTTAGGATACGGCTGGGTCTTACTTGTCATTGGAGTC
ATCAGAGAACTCTTTGGTTTTGGAACTCTTATGGGGTTTCGCATCATCCC
TCAATTTGTTTATGCTTCCGAAACCCACCCCGATGGATACCAAAATTTAA
GTCTTATGGTGCTAGCACCGTCGGCTTTTTTCCTACTTGGTATTATGATT
TGGCTTGTTAACATTCGAGACTCTAAAAAGAGAAAAAGGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy