Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR342 IGR341 IGR339 IGR344 IGR343 IGR340 IGR345 IGR338 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0434 CPn0423 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0434 CPn0423 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0434 CPn0432 CPn0423 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 nqr4, - CPn0429 nqr4, - CPn0429
* Calculated from Protein Sequence

Gene ID: CPn0428

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqr3  

Definition:
Na+-translocating NADH-quinone reductase, chaingamma (possible nqr3)

Gene Start:
473722

Gene Stop:
474684

Gene Length:
963

Molecular Weight*:
35555

pI*:
5.50

Net Charge*:
-4.16

EC:
1.6.5.3  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and OtherSubstances; Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to
M. genitalium, T. pallidum and U. urealyticum.

CPn0428 is orthologously related to CT279:
residues 5-320 are 54% similar to residues
2-312 of CT279.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 183 to 302 (E-value = 3.8e-40) place CPn0428 in the FMN_bind family which is described as FMN-binding domain (PF04205)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
20  
37
transmembrane  
177  
194

PDB Hit:


Gene Protein Sequence:
MSKGSSKHTVRINQTWYIVSFILGLSLFAGVLLSTIYYVLSPIQEQAATF
DRNKQMLLAAHILDFKGRFQIQEKKEWVPATFDKKTQLLEVATKKVSEVS
YPELELYAERFVRPLLTDAQGKVFSFEEKNLNPIEFFEKYQESPPCQQSP
LPFYVILENTSRTENMSGADVAKDLSTVQALIFPISGFGLWGPIHGYLGV
KNDGDTVLGTAWYQQGETPGLGANITNPEWQEQFYGKKIFLQDSSGTTNF
ATTDLGLEVVKGSVRTTLGDSPKALSAIDGISGATLTCNGVTEAYVQSLA
CYRQLLINFSNLTHEKKTGE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAAAGGCTCTTCAAAACATACCGTCCGCATAAACCAAACCTGGTA
CATCGTTTCCTTTATCCTGGGCCTCAGCTTATTTGCAGGAGTGCTGTTAT
CCACAATCTACTATGTGCTCTCCCCAATACAGGAACAAGCTGCTACTTTC
GATCGCAATAAGCAAATGCTTTTAGCTGCTCATATTTTAGATTTTAAAGG
AAGATTTCAAATTCAGGAAAAAAAAGAGTGGGTGCCTGCGACTTTCGATA
AAAAAACACAACTTCTTGAAGTTGCTACAAAAAAAGTCTCTGAGGTTTCC
TATCCTGAATTAGAGCTGTATGCCGAGCGCTTTGTCCGTCCTCTACTTAC
AGATGCCCAAGGCAAGGTATTTTCTTTTGAAGAAAAAAATCTGAATCCCA
TTGAATTTTTTGAGAAATATCAAGAAAGCCCTCCGTGTCAGCAATCCCCC
CTCCCCTTTTATGTCATTTTAGAGAATACCTCTCGCACAGAAAATATGTC
AGGAGCCGACGTTGCGAAAGACCTTTCTACAGTTCAAGCTTTGATCTTCC
CTATATCAGGATTCGGCCTTTGGGGCCCCATCCATGGCTATCTAGGAGTG
AAAAACGACGGTGACACTGTATTGGGAACCGCATGGTACCAACAAGGAGA
AACTCCAGGTTTAGGAGCAAATATTACAAATCCCGAATGGCAAGAGCAAT
TCTATGGGAAGAAAATCTTCCTACAAGATTCTTCTGGAACTACAAATTTT
GCAACAACAGACCTAGGGCTTGAGGTAGTTAAAGGTTCCGTGCGTACTAC
TTTGGGAGATTCTCCAAAAGCTCTTTCTGCTATTGATGGGATTTCTGGAG
CCACCTTAACATGCAACGGTGTCACTGAAGCTTATGTACAATCTCTGGCT
TGCTATCGTCAGCTCCTTATAAATTTTTCTAATTTAACCCATGAAAAGAA
AACAGGCGAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy