Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR341 IGR342 IGR337 IGR339 IGR344 IGR343 IGR340 IGR345 IGR336 IGR338 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0421 CPn0434 CPn0423 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0432 CPn0431 gcvT,gcsH, - CPn0433 CPn0426 CPn0421 CPn0434 CPn0423 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0431 CPn0426 CPn0421 CPn0434 gcvT,gcsH, - CPn0433 CPn0432 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 nqr4, - CPn0429 nqr4, - CPn0429 CPn0423
* Calculated from Protein Sequence

Gene ID: CPn0427

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqr2  

Definition:
NADH dehydrogenase (ubiquinone)

Gene Start:
472207

Gene Stop:
473718

Gene Length:
1512

Molecular Weight*:
55270

pI*:
9.50

Net Charge*:
8.69

EC:
1.6.5.3  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and OtherSubstances; Ubiquinone biosynthesis

Comment:
Probable NADH-ubiquinone oxidoreductase subunit
2 (nqr2). A pI of approx. 8 is comparable to the
pI of the ubiquinone sequences. See
CT278, CT279, CT280, and CT281: compact
intergenic
spacing suggests that CT278, CT279, CT280, and
CT281 may
be a single transcriptional unit for nqr2-nqr5,
with nqr1 encoded possibly by CT634
and nqr6 by CT740.

Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to
M. genitalium, T. pallidum and U. urealyticum.

CPn0427 is orthologously related to CT278 and
they share 71% similarity.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1805
COG name: Uncharacterized membrane protein, RnfD family
Functional Class:  S
The phylogenetic pattern of COG1805 is ------vce--H------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
56  
73
transmembrane  
114  
131
transmembrane  
164  
181
transmembrane  
364  
382
transmembrane  
387  
406
transmembrane  
419  
436
transmembrane  
454  
471
transmembrane  
476  
493

PDB Hit:


Gene Protein Sequence:
MLKKFINSLWKLCQQDKYQRFTPIVDAIDTFCYEPIETPSKPPFIRDSVD
VKRWMMLVVIALFPATFVAIWNSGLQSIVYSSGNPVLMEQFLHISGFGSY
LSFVYKEIHIVPILWEGLKIFIPLLTISYVVGGTCEVLFAVVRGHKIAEG
LLVTGILYPLTLPPTIPYWMAALGIAFGIVVSKELFGGTGMNILNPALSG
RAFLFFTFPAKMSGDVWVGSNPGVIKDSLMKMNSSTGKVLIDGFSQSTCL
QTLNSTPPSVKRLHVDAIAANMLHIPHVPTQDVIHSQFSLWTETHPGWVL
DNLTLTQLQTFVTAPVAEGGLGLLPTQFDSAYAITDVIYGIGKFSAGNLF
WGNIIGSLGETSTFACLLGAIFLIVTGIASWRTMAAFGIGAFLTGWLFKF
ISVLIVGQNGAWAPARFFIPAYRQLFLGGLAFGLVFMATDPVSSPTMKLG
KWIYGFFIGFMTIVIRLINPAYPEGVMLAILLGNVFAPLIDYFAVRKYRK
RGV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCAAAAAATTCATAAATTCTCTTTGGAAACTATGTCAACAAGACAA
GTATCAGCGCTTTACTCCCATTGTCGATGCGATAGATACATTTTGTTACG
AACCTATTGAAACCCCTTCCAAGCCTCCTTTCATCCGCGATTCTGTAGAT
GTTAAGCGTTGGATGATGCTTGTTGTTATCGCTTTGTTTCCCGCGACCTT
TGTTGCGATCTGGAATTCAGGACTTCAATCTATCGTTTATAGCTCAGGCA
ATCCTGTGCTGATGGAGCAATTCTTACATATTTCTGGATTTGGTAGTTAT
TTATCCTTTGTTTACAAAGAGATCCATATAGTTCCTATCCTTTGGGAAGG
ACTTAAGATCTTTATTCCTCTACTTACGATTAGCTATGTTGTCGGGGGTA
CTTGTGAGGTCCTATTTGCTGTAGTTCGTGGGCATAAAATCGCAGAAGGA
CTGCTAGTAACCGGAATCCTCTATCCCCTTACTCTCCCTCCGACAATTCC
TTACTGGATGGCAGCCTTAGGGATCGCCTTTGGTATTGTTGTCAGTAAAG
AGCTCTTCGGAGGCACAGGGATGAACATCCTCAATCCTGCTCTATCAGGA
AGGGCATTCTTATTTTTTACGTTTCCAGCAAAGATGAGTGGTGACGTTTG
GGTAGGAAGCAACCCCGGAGTGATTAAAGATAGCCTCATGAAGATGAACT
CCTCGACAGGAAAAGTACTCATTGATGGATTTTCACAGTCTACCTGCCTA
CAAACTCTAAATTCGACACCTCCCTCTGTAAAGCGTCTGCATGTCGATGC
GATTGCTGCAAATATGCTTCACATTCCTCACGTCCCTACTCAAGATGTCA
TTCACTCACAATTTTCTCTTTGGACAGAGACGCATCCTGGTTGGGTTTTA
GATAATCTCACTCTTACACAACTTCAAACGTTTGTTACAGCTCCTGTTGC
TGAGGGAGGATTGGGGCTGCTTCCCACACAGTTCGATTCTGCCTATGCTA
TTACCGATGTGATCTATGGGATTGGGAAGTTCTCAGCTGGGAATCTCTTT
TGGGGAAACATTATAGGTTCTCTGGGGGAGACCTCCACTTTCGCCTGTCT
GTTGGGTGCAATATTCCTTATTGTTACAGGCATTGCCTCTTGGAGAACCA
TGGCAGCCTTTGGGATAGGAGCCTTTCTCACAGGCTGGCTCTTTAAGTTT
ATCAGCGTACTCATCGTGGGACAAAACGGAGCTTGGGCACCTGCTCGATT
CTTCATTCCCGCCTATCGGCAGCTTTTCCTCGGAGGACTTGCTTTTGGTT
TAGTCTTTATGGCTACGGATCCCGTATCATCGCCGACTATGAAATTAGGG
AAATGGATTTACGGATTCTTTATAGGATTTATGACTATTGTGATTCGTCT
TATCAATCCTGCGTATCCTGAGGGAGTGATGTTAGCGATCCTTCTGGGCA
ATGTATTTGCCCCTCTTATCGACTATTTTGCTGTTAGAAAGTATAGAAAA
AGGGGAGTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy