Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR341 IGR342 IGR337 IGR339 IGR344 IGR343 IGR340 IGR345 IGR336 IGR338 CPn0432 CPn0431 CPn0426 CPn0421 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0432 CPn0431 CPn0426 CPn0421 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0431 CPn0426 CPn0420 pbp2,penA, - CPn0419 CPn0432 CPn0421 CPn0420 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 nqr4, - CPn0429 nqr4, - CPn0429 CPn0423
* Calculated from Protein Sequence

Gene ID: CPn0426

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
472111

Gene Stop:
471533

Gene Length:
579

Molecular Weight*:
21448

pI*:
8.50

Net Charge*:
6.71

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0427 is weakly similar to CT277, a hypothetical protein: residues 7-186 are 29% similar to CT277.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
14

PDB Hit:


Gene Protein Sequence:
MVLFSLLFPKLCYGCQAPGAYFCSNCLEKLLVEDREGRCLHCFRYLGSSE
TRLCSQCSPSSQLQAFSLYLPSQTALSVYARACEGKRPALQFFSKSIAFE
LASLDETPSCIAYITSTISRKIVVEVAKLEKLLRIPLWPWLPKKRQIEKL
PKGEGICFLSAYPLSQKWMQTIVGGSASPLVSISLFLSQNDQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTACTTTTTTCGTTGCTGTTTCCAAAGTTATGTTATGGCTGTCAAGC
TCCAGGAGCCTACTTTTGTTCCAACTGCTTGGAAAAACTTCTCGTAGAAG
ATAGAGAAGGGCGTTGTCTACATTGTTTTCGTTATCTTGGTTCTTCCGAA
ACACGTCTATGTAGCCAGTGTTCACCCTCTTCACAACTTCAAGCTTTCAG
CTTGTACCTTCCTTCGCAAACGGCCCTCTCGGTATATGCTCGTGCTTGTG
AAGGTAAGCGACCCGCTCTGCAGTTTTTTTCTAAGAGTATCGCCTTTGAG
CTAGCTTCACTGGATGAGACTCCGAGTTGTATTGCCTATATAACATCGAC
AATTTCTAGGAAAATCGTAGTAGAAGTTGCTAAACTAGAAAAGCTTTTAC
GCATTCCCTTGTGGCCGTGGCTTCCTAAGAAAAGACAAATAGAAAAACTT
CCTAAAGGGGAAGGTATCTGCTTTTTGTCGGCCTATCCTTTATCACAAAA
ATGGATGCAAACTATCGTTGGAGGGAGTGCATCACCTCTAGTATCTATAA
GTCTCTTTCTCTCTCAGAATGATCAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy