Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR342 IGR341 IGR337 IGR339 IGR343 IGR340 IGR336 IGR338 CPn0431 CPn0426 CPn0421 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0431 CPn0426 CPn0421 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0431 CPn0426 CPn0421 pbp2,penA, - CPn0419 CPn0420 CPn0420 CPn0422 CPn0425 nqr5, - CPn0430 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 nqr4, - CPn0429 nqr4, - CPn0429 CPn0423
* Calculated from Protein Sequence

Gene ID: CPn0425

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
470980

Gene Stop:
471567

Gene Length:
588

Molecular Weight*:
21311

pI*:
4.60

Net Charge*:
-10.55

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0425 is weakly similar to TP0253, TP0048 and TP0267, all hypothetical proteins in T. pallidum. No similarities to M. genitalium or U. urealyticum sequences.

CPn0425 is orthologously related CT276, a conserved hypothetical protein and they share 57% similarity.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1664
COG name: Uncharacterized BCR
Functional Class:  S
The phylogenetic pattern of COG1664 is ------------uj--OLin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 74 to 186 (E-value = 1.7e-44) place CPn0425 in the DUF583 family which is described as Protein of unknown function, DUF583 (PF04519)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
195

PDB Hit:


Gene Protein Sequence:
MFRRTGKGPFEDVQTLYEEETSSPSSYSPYSRSERPETPPSLFDNPKASE
ARPLNHNLTEESSLPQWSSTPRTESLLPLEEPETTLGEGVTFKGELAFER
LLRIDGTFEGILVSKGKIIIGPKGVVKADIQLQEAIIEGVVEGNITVSGK
VELRGGAIIKGDIQANTLCVDEGVRILGYLAIAGITDHSERERDL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCCGTAGAACAGGAAAAGGTCCTTTTGAAGATGTGCAAACACTTTA
CGAAGAAGAAACTTCTTCACCTTCCAGCTACTCGCCATATTCAAGATCCG
AGCGCCCAGAGACCCCTCCAAGTCTTTTTGACAACCCTAAAGCTTCGGAA
GCTCGCCCTTTGAATCACAATTTAACTGAAGAATCTTCTCTTCCTCAATG
GTCCTCAACTCCAAGAACAGAATCTCTACTCCCTCTTGAAGAACCTGAAA
CTACCTTAGGAGAAGGCGTCACCTTTAAAGGAGAACTTGCTTTTGAACGT
CTCCTACGTATTGACGGAACTTTTGAAGGCATTTTAGTCTCAAAAGGAAA
AATTATTATCGGTCCTAAAGGAGTGGTAAAGGCAGATATTCAGCTACAAG
AAGCCATTATTGAAGGGGTTGTAGAAGGAAATATCACAGTATCTGGAAAA
GTCGAACTCCGTGGAGGCGCAATCATTAAAGGAGACATCCAAGCGAACAC
GTTGTGTGTTGATGAGGGCGTACGTATTCTTGGTTACCTTGCAATTGCAG
GAATTACTGATCATTCTGAGAGAGAAAGAGACTTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy