Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR341 IGR337 IGR339 IGR340 IGR336 IGR338 CPn0426 CPn0421 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0426 CPn0421 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0426 CPn0421 pbp2,penA, - CPn0419 CPn0420 CPn0420 CPn0422 CPn0425 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 nqr4, - CPn0429 nqr4, - CPn0429 CPn0423
* Calculated from Protein Sequence

Gene ID: CPn0424

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaA  

Definition:
DnaA replication protein

Gene Start:
469612

Gene Stop:
470964

Gene Length:
1353

Molecular Weight*:
51227

pI*:
8.20

Net Charge*:
7.46

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
n E. coli, the DNAA enzyme binds to the origin
of replication, at a 9-nt consensus called a DNAA box:
5'-TTATC(C/A)A(C?A)A-3'. See the paralog (isolog?) CPn0309.

From Prosite PDOC00771:

The bacterial dnaA protein plays an important
role in initiating and regulating chromosomal
replication. DnaA is an ATP- and DNA-binding
protein. It binds specifically to 9 bp
nucleotide repeats known as dnaA boxes which are
found in the chromosome origin of replication
(oriC).

DnaA is a protein of about 50 Kd that contains
two conserved regions: the first is located in
the N-terminal half and corresponds to the
ATP-binding domain, the second is located in the
C-terminal half and could be involved in
DNA-binding.

Blast Summary:  PSI-Blast Search
CPn0424 is similar to TP0001 in T. pallidum,
MG469 in M.genitalium and UU001 in U. urealyticum.
They are all predicted chromosomal replication
initiation protein.

CPn0424 is orthologously related to CT275, a
predicted DnaA replication protein. They share
83% similarity. CPn0424 is also similar to CT250.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0593
COG name: ATPase involved in DNA replication initiation
Functional Class:  L
The phylogenetic pattern of COG0593 is -----qvcEbrHujgpolINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0424 is paralogously related to CPn0309, a
predicted replication initiation factor: residues
10-434 are 25% similar to CPn0309.

Pfam Summary:  Pfam Search
Residues 116 to 427 (E-value = 5.9e-142) place CPn0424 in the Bac_DnaA family which is described as Bacterial dnaA protein (PF00308)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
395  
413

PDB Hit:


Gene Protein Sequence:
MLTCNECTTWEQFLNYVKTRCSKTAFENWISPIQVLEETQEKIRLEVPNI
FVQNYLLDNYKRDLCSFVPLDVHGEPALEFVVAEHKKPSAPVASQKESNE
GISEVFEETKDFELKLNLSYRFDNFIEGPSNQFVKSAAVGIAGKPGRSYN
PLFIHGGVGLGKTHLLHAVGHYVREHHKNLRIHCITTEAFINDLVYHLKS
KSVDKMKNFYRSLDLLLVDDIQFLQNRQNFEEEFCNTFETLINLSKQIVI
TSDKPPSQLKLSERIIARMEWGLVAHVGIPDLETRVAILQHKAEQKGLLI
PNEMAFYIADHIYGNVRQLEGAINKLTAYCRLFGKSLTETTVRETLKELF
RSPTKQKISVETILKSVATVFQVKLNDLKGNSRSKDLVLARQIAMYLAKT
LITDSLVAIGAAFGKTHSTVLYACKTIEHKLQNDETLKRQVNLCKNHIVG
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAACCTGTAACGAGTGCACTACTTGGGAACAGTTTTTAAATTATGT
TAAGACACGTTGCTCGAAAACGGCTTTTGAAAATTGGATTTCTCCTATTC
AAGTTCTTGAAGAAACTCAAGAGAAAATTCGCTTAGAAGTCCCCAACATT
TTTGTACAAAATTATCTTCTTGATAACTACAAAAGAGACCTCTGTTCTTT
TGTCCCCTTAGATGTTCATGGAGAGCCTGCTTTAGAATTTGTAGTTGCAG
AACACAAGAAACCTTCAGCCCCCGTGGCTTCTCAAAAAGAATCAAACGAA
GGAATTTCTGAGGTCTTTGAAGAAACTAAAGATTTTGAATTAAAGCTGAA
TCTCTCCTATCGCTTTGATAATTTCATTGAAGGTCCCTCAAATCAATTTG
TGAAGTCTGCAGCTGTAGGTATTGCTGGGAAACCTGGCCGCTCCTACAAC
CCTTTATTCATCCATGGGGGTGTGGGATTAGGCAAAACGCATTTACTTCA
TGCCGTAGGTCACTACGTAAGAGAACATCATAAAAATCTACGCATCCATT
GCATCACTACAGAAGCGTTTATCAACGATCTTGTCTACCATCTCAAATCC
AAGTCTGTTGATAAAATGAAAAATTTTTATCGTTCCCTAGATTTACTTCT
TGTTGATGATATTCAATTTTTACAGAATCGCCAAAATTTTGAAGAAGAGT
TTTGCAATACCTTTGAGACTTTGATCAACCTGAGTAAGCAAATTGTAATT
ACCAGTGATAAACCTCCAAGTCAGCTCAAACTTTCCGAGCGTATCATTGC
TAGAATGGAATGGGGACTGGTTGCTCACGTCGGCATCCCTGATTTAGAAA
CTCGGGTTGCGATTTTACAGCACAAGGCGGAGCAAAAAGGATTGCTCATT
CCTAATGAAATGGCATTTTATATTGCGGATCACATCTATGGCAATGTCCG
TCAATTGGAAGGAGCTATCAACAAGCTGACTGCCTATTGTCGTCTTTTCG
GCAAGTCTCTTACAGAAACTACAGTCCGAGAAACTCTAAAAGAGCTCTTC
CGTTCTCCAACAAAACAAAAAATTTCTGTAGAAACGATCTTAAAAAGTGT
TGCTACAGTATTCCAAGTAAAGCTGAATGATCTTAAGGGAAACTCACGCT
CTAAAGATCTTGTGTTAGCTCGGCAAATTGCTATGTATTTAGCAAAAACT
CTTATTACAGATTCTTTAGTTGCAATAGGAGCTGCTTTTGGTAAAACTCA
TTCGACAGTACTTTATGCCTGTAAAACTATAGAACATAAATTACAAAATG
ACGAAACTCTTAAGCGTCAAGTAAATCTCTGTAAAAATCATATTGTTGGT
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy