Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR341 IGR337 IGR339 IGR340 IGR336 IGR338 IGR335 CPn0426 CPn0421 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0426 CPn0421 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0426 CPn0421 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0420 CPn0420 CPn0422 CPn0425 nqr3, - CPn0428 dnaA, - CPn0424 nqr2, - CPn0427 CPn0423
* Calculated from Protein Sequence

Gene ID: CPn0423

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
468791

Gene Stop:
469219

Gene Length:
429

Molecular Weight*:
15699

pI*:
5.00

Net Charge*:
-4.38

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0423 is orthologously related to CT274, a hypothetical protein: residues 1-132 are 87% similar to that of CT274.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0457
COG name: TPR-repeat-containing proteins
Functional Class:  R
The phylogenetic pattern of COG0457 is AMTKYQVCEB-HUJ--OLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MLDNEWKAILGWGDDELEELRISGYSFLRQGHYSKAILFFEALVILDPLS
IYDHQTLGGLYLQIGENSQALAVLDQALRMQGDHLPTLLNKTKALFCLGR
IEEATAIATYLSSCPIPAIANDAEALLMSYSKATKKNAALVR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGGATAATGAATGGAAAGCAATCTTAGGCTGGGGAGATGATGAGTT
AGAAGAACTCAGAATCTCAGGATATTCTTTTCTACGCCAAGGGCATTATT
CAAAAGCGATTCTTTTTTTTGAAGCTCTAGTGATCTTAGATCCTTTAAGT
ATCTATGATCATCAAACTCTTGGAGGTCTTTATCTCCAAATTGGTGAAAA
TAGTCAGGCGCTTGCTGTTTTAGATCAGGCACTCCGCATGCAAGGAGATC
ATCTGCCTACACTCTTAAATAAAACAAAAGCTCTCTTCTGTTTGGGACGA
ATTGAAGAAGCTACTGCCATTGCCACCTACCTTTCATCCTGTCCCATACC
AGCAATTGCTAATGATGCTGAAGCTCTATTGATGAGTTATAGTAAAGCAA
CCAAAAAAAATGCTGCGTTAGTTCGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy