Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR337 IGR339 IGR340 IGR336 IGR338 IGR335 CPn0426 CPn0421 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 dnaA, - CPn0424 nqr2, - CPn0427 CPn0426 CPn0421 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0423 CPn0422 CPn0425 dnaA, - CPn0424 nqr2, - CPn0427 CPn0426 CPn0421 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0420 amiA, - CPn0417 amiA, - CPn0417 CPn0420 CPn0422 CPn0425 dnaA, - CPn0424 nqr2, - CPn0427 CPn0423
* Calculated from Protein Sequence

Gene ID: CPn0421

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
467998

Gene Stop:
467105

Gene Length:
894

Molecular Weight*:
33825

pI*:
8.20

Net Charge*:
3.76

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0421 is similar to TP0384 in T. pallidum, UU386 in U. urealyticum and MG222 in M. genitalium. They are all hypothetical proteins.

CPn0421 is orthologously related to CT272, a conserved hypothetical protein: residues 6-295 are 67% similar to CT272.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0275
COG name: Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis
Functional Class:  M
The phylogenetic pattern of COG0275 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 295 (E-value = 9.2e-138) place CPn0421 in the Methyltransf_5 family which is described as MraW methylase family (PF01795)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
53  
87

PDB Hit:


Gene Protein Sequence:
MSERAHIPVLVEECLALFAQRPPQTFRDVTLGAGGHAYAFLEAYPSLTCY
DGSDRDLQALAIAEKRLETFQDRVSFSHASFEDLANQPTPRLYDGVLADL
GVSSMQLDTLSRGFSFQGEKEELDMRMDQTQELSASDVLNSLKEEELGRI
FREYGEEPQWKSAAKAVVHFRKHKKILSIQDVKEALLGVFPHYRFHRKIH
PLTLIFQALRVYVNGEDRQLKSLLTSAISWLAPQGRLVIISFCSSEDRPV
KWFFKEAEASGLGKVITKKVIQPTYQEVRRNPRSRSAKLRCFEKASQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGAACGTGCGCATATTCCCGTATTAGTTGAAGAATGTTTAGCTTT
ATTTGCTCAACGTCCTCCACAGACTTTTCGAGATGTCACCTTAGGAGCTG
GAGGACATGCGTATGCTTTTCTTGAGGCGTATCCCTCTCTAACTTGTTAT
GATGGCTCCGATCGAGATCTTCAGGCTTTGGCAATTGCAGAAAAACGTTT
GGAGACCTTTCAAGATAGAGTCTCCTTTTCCCACGCCTCTTTTGAAGATC
TTGCGAACCAACCCACTCCACGTCTTTATGACGGAGTTCTTGCAGATTTA
GGAGTCTCTTCTATGCAGCTGGATACTCTATCCCGAGGGTTTAGCTTTCA
AGGGGAAAAAGAAGAGTTGGATATGCGTATGGATCAAACGCAAGAGCTTT
CCGCTAGCGATGTCCTGAACTCCCTAAAAGAAGAAGAACTAGGGAGAATT
TTTCGTGAATATGGAGAGGAACCACAATGGAAATCTGCAGCTAAAGCTGT
TGTCCATTTTCGTAAGCATAAAAAAATTCTTTCGATCCAGGATGTAAAAG
AAGCTCTTCTTGGCGTTTTCCCTCACTATCGTTTTCATAGAAAAATACAT
CCACTCACCTTGATTTTTCAAGCTCTACGTGTTTATGTGAATGGAGAGGA
TAGACAATTGAAAAGTTTACTAACATCTGCTATATCTTGGCTGGCTCCTC
AGGGACGGCTTGTCATTATTTCTTTTTGTAGCTCTGAGGATCGTCCTGTG
AAGTGGTTTTTTAAAGAGGCGGAAGCTTCTGGCCTGGGGAAGGTAATCAC
AAAGAAAGTGATCCAACCTACCTACCAAGAAGTACGAAGAAATCCTAGAT
CGAGATCAGCAAAACTACGGTGTTTTGAAAAAGCTTCCCAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy