Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_1 IGR337 IGR333 IGR336 IGR334 IGR338 IGR335 ihfA,himD, - CPn0416 CPn0421 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0423 CPn0422 dnaA, - CPn0424 ihfA,himD, - CPn0416 CPn0421 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0423 CPn0422 dnaA, - CPn0424 CPn0421 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 CPn0420 amiA, - CPn0417 amiA, - CPn0417 CPn0420 ihfA,himD, - CPn0416 CPn0422 dnaA, - CPn0424 CPn0423
* Calculated from Protein Sequence

Gene ID: CPn0419

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pbp2  penA  

Definition:
penicillin binding protein 2

Gene Start:
466834

Gene Stop:
464873

Gene Length:
1962

Molecular Weight*:
73656

pI*:
9.80

Net Charge*:
17.57

EC:
 

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table

Comment:
In non-beta-lactamase producing bacteria, this
PBP2 protein is found to have reduced affinity
for penicillin and to form the basis for
drug-resistance in Neisseria species.

Blast Summary:  PSI-Blast Search
CPn0419 is similar to TP0760 and TP0500, both predicted penicillin-binding proteins in T. pallidum. No similarities to M. genitalium or U. urealyticum sequences.

CPn0419 is orthologously related to CT270, a predicted penicillin binding protein 2: residues 1-645 are 66% similar to CT270. CPn0419 is also similar to CT682, a probable penicillin-binding protein 2.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0768
COG name: Cell division protein FtsI/penicillin-binding protein 2
Functional Class:  M
The phylogenetic pattern of COG0768 is -----QVcEBRHUJ--OLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 49 to 226 (E-value = 3.6e-26) place CPn0419 in the PBP_dimer family which is described as Penicillin-binding Protein dimerisation domain (PF03717)
Residues 265 to 612 (E-value = 6.9e-39) place CPn0419 in the Transpeptidase family which is described as Penicillin binding protein transpeptidase domain (PF00905)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
16
coil-coil  
626  
653

PDB Hit:


Gene Protein Sequence:
MSYRKRSTLIVLGVFALYALLVLRYYKIQICEGDHWAAEALGQHEFCVRD
PFRRGTFFANTTVRKGDKDLQQPFAVDITKFHLCADPLAIPECHRDEIIQ
GILQFIEGQTYDDLSLKLDKKSRYCKLYPLLDVSVHDRLSLWWKGYATKH
RLPTNALFFITDYQRSYPFGKLLGQVLHTLREIKDEKTGKAFPTGGMEAY
FNHILEGDVGERKLLRSPLNRLDTNRVIKLPKDGSDIYLTINPVIQTIAE
EELERGVLEAKAQGGRLILMNSQTGEILALAQYPFFDPTNYKEYFNNKER
IEHTKVSFVSDVFEPGSIMKPLTVAIALQANEEASLKSQKKIFDPEEPID
VTRTLFPGRKGSPLKDISRNSQLNMYMAIQKSSNVYVAQLADRIIQSLGV
AWYQQKLLALGFGRKTGIELPSEASGLVPSPHRFHINGSLEWSLSTPYSL
AMGYNILATGIQMVQAYAILANGGYAVRPTLVKKIVSASGEEYHLPTKEK
TRLFSEEITREVVRAMRFTTLPGGSGFRASPKHHSSAGKTGTTEKMIHGK
YDKRRHIASFIGFTPVESSEGNFPPLVMLVSIDDPEYGLRADGTKNYMGG
RCAAPIFSRVADRTLLYLGILPDKKLRNCDEEAAALKRLYEEWNRSPKQG
GTR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTACCGTAAACGTTCGACTCTAATTGTTCTAGGAGTGTTTGCTCT
TTATGCTCTTCTAGTATTGCGTTATTATAAAATTCAAATTTGTGAAGGAG
ACCACTGGGCCGCAGAAGCTCTCGGGCAACACGAATTTTGTGTCCGTGAT
CCTTTTCGAAGGGGCACCTTTTTTGCTAACACGACAGTACGTAAGGGAGA
CAAAGACCTTCAGCAGCCTTTCGCTGTCGATATTACAAAATTTCACCTTT
GTGCAGATCCTTTAGCTATTCCCGAATGTCATCGTGATGAGATCATCCAA
GGGATTCTCCAATTTATTGAGGGGCAGACCTACGACGACCTCTCCCTAAA
GTTAGATAAGAAATCTCGGTATTGTAAGCTGTATCCTTTATTAGATGTTT
CTGTCCATGACCGGCTATCCCTTTGGTGGAAAGGATATGCAACAAAGCAT
CGCTTACCAACAAACGCCCTATTTTTTATTACGGACTACCAACGCTCGTA
TCCTTTTGGGAAGCTCCTTGGACAAGTTCTCCATACCTTAAGAGAAATTA
AGGATGAGAAAACAGGAAAAGCCTTTCCCACAGGCGGGATGGAGGCGTAC
TTTAATCATATTCTGGAAGGGGACGTTGGAGAGAGAAAGCTGTTGCGTTC
TCCTTTGAACCGTTTAGATACGAATCGTGTTATCAAACTGCCTAAAGATG
GCTCTGATATCTACCTTACGATCAATCCTGTGATCCAGACCATTGCAGAG
GAAGAACTCGAACGGGGCGTGCTAGAAGCTAAAGCCCAGGGGGGTAGGCT
CATTCTAATGAACTCCCAAACAGGAGAGATTCTTGCACTGGCTCAATATC
CGTTTTTCGATCCCACAAATTATAAGGAATACTTCAATAACAAAGAGCGC
ATCGAACATACGAAGGTATCTTTTGTGAGCGATGTTTTTGAACCCGGGTC
GATCATGAAACCTTTGACTGTGGCGATTGCTTTACAAGCTAACGAAGAGG
CTAGCTTAAAATCGCAGAAAAAGATTTTTGATCCTGAAGAACCTATCGAT
GTGACCAGGACACTCTTCCCTGGACGAAAAGGATCTCCGCTTAAGGATAT
TTCTAGAAACTCTCAATTGAATATGTACATGGCTATCCAGAAATCTTCGA
ATGTCTATGTAGCTCAGCTGGCTGACCGCATCATACAATCTTTAGGAGTG
GCCTGGTACCAACAGAAGTTGCTAGCTCTGGGATTTGGAAGAAAAACAGG
GATCGAGCTTCCCAGTGAGGCCTCTGGTTTGGTGCCTTCTCCCCATCGTT
TCCATATTAATGGTTCCCTGGAATGGTCCTTATCTACTCCATATTCTTTG
GCTATGGGATATAATATTTTGGCAACAGGGATACAAATGGTTCAAGCCTA
CGCTATCCTTGCAAACGGAGGTTATGCCGTCCGGCCCACTTTAGTAAAAA
AGATCGTCTCTGCTTCAGGAGAGGAATATCATCTTCCTACTAAAGAGAAG
ACACGACTCTTTTCAGAAGAAATTACTAGAGAAGTTGTTCGTGCCATGCG
TTTTACAACGTTACCCGGAGGTTCGGGATTTCGAGCCTCTCCTAAGCATC
ACTCTAGTGCTGGGAAAACAGGAACTACAGAAAAGATGATTCATGGAAAA
TATGATAAACGCCGTCATATTGCTTCTTTTATAGGTTTTACTCCCGTAGA
GAGCTCGGAGGGAAATTTCCCACCTTTAGTGATGCTCGTCTCCATAGATG
ATCCTGAATATGGTTTGCGAGCCGACGGCACGAAAAATTATATGGGGGGG
CGTTGTGCGGCACCCATTTTTTCTAGGGTTGCTGACCGCACACTCCTCTA
TTTAGGGATTCTTCCAGACAAGAAGCTAAGAAATTGCGACGAAGAAGCTG
CTGCATTAAAGCGTCTCTATGAAGAATGGAATCGTTCTCCGAAACAAGGG
GGAACGAGGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy