Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_1 IGR333 IGR332 IGR336 IGR334 IGR335 ihfA,himD, - CPn0416 CPn0421 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 CPn0422 ihfA,himD, - CPn0416 CPn0421 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 CPn0422 ihfA,himD, - CPn0416 CPn0421 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 CPn0420 amiA, - CPn0417 accA, - CPn0414 amiA, - CPn0417 accA, - CPn0414 CPn0420 CPn0422
* Calculated from Protein Sequence

Gene ID: CPn0418

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murE  

Definition:
N-acetylymuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase

Gene Start:
464401

Gene Stop:
462950

Gene Length:
1452

Molecular Weight*:
52709

pI*:
5.50

Net Charge*:
-9.80

EC:
6.3.2.13  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis Metabolism of Complex Carbohydrates; Peptideglycan biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
CPn0418 is similar to TP0933, a predicted UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase in T. pallidum.

CPn0418 is orthologously related to CT269, a predicted N-acetylymuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase: residues 1-481 are 58% similar to CT269. CPn0418 is also similar to CT758 and CT756.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0769
COG name: UDP-N-acetylmuramyl tripeptide synthase
Functional Class:  M
The phylogenetic pattern of COG0769 is --T--qvCebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0418 is weakly similar to CPn0899, a predicted muramoyl-DAP ligase and to CPn0901, a predicted muramoylalanine-glutamate ligase

Pfam Summary:  Pfam Search
Residues 35 to 319 (E-value = 7.8e-68) place CPn0418 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 328 to 416 (E-value = 7.5e-26) place CPn0418 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
58  
75
transmembrane  
291  
308

PDB Hit:


Gene Protein Sequence:
MDLKELLHGVQAKIYGKVRPLEVRNLTRDSRCVSVGDIFIAHKGQRYDGN
DFAVDALANGAIAIASSLYNPFLSVVQIITPNLEELEAELSAKYYEYPSS
KLHTIGVTGTNGKTTVTCLIKALLDSYQKPSGLLGTIEHILGEGVIKDGF
TTPTPALLQKYLATMVRQNRDAVVMEVSSIGLASGRVAYTNFDTAVLTNI
TLDHLDFHGTFETYVAAKAKLFSLVPPSGMVVINTDSPYASQCIESAKAP
VITYGIESAADYRATDIQLSSSGTKYTLVYGDQKIACSSSFIGKYNVYNL
LAAISTVHASLRCDLEDLLEKIGLCQPPPGRLDPVLMGPCPVYIDYAHTP
DALDNVLTGLHELLPEGGRLIVVFGCGGDRDRSKRKLMAQVVERYGFAVV
TSDNPRSEPPEDIVNEICDGFYSKNYFIEIDRKQAITYALSIASDRDIVL
IAGKGHEAYQIFKHQTVAFDDKQTVCEVLASYV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTAAAAGAGTTACTCCATGGGGTTCAAGCTAAAATCTATGGGAA
AGTTCGCCCTCTTGAAGTGCGCAACTTGACACGTGATTCCCGTTGTGTGA
GTGTTGGCGACATTTTTATAGCCCATAAGGGACAGCGCTACGACGGAAAT
GATTTTGCTGTCGATGCTTTAGCTAATGGAGCAATTGCCATTGCTTCTTC
ACTATACAATCCGTTTCTTTCCGTTGTTCAGATCATCACTCCTAATCTCG
AAGAATTAGAGGCTGAGCTTTCTGCAAAGTATTACGAATACCCTTCAAGT
AAGCTCCATACCATTGGGGTGACTGGAACCAATGGGAAAACTACAGTTAC
ATGTTTGATTAAAGCTTTATTGGATAGCTATCAAAAACCTTCAGGGCTTT
TAGGAACCATAGAGCATATCTTAGGAGAGGGGGTGATTAAAGATGGGTTT
ACTACACCTACACCCGCTCTTTTACAGAAGTATTTAGCCACTATGGTACG
TCAAAATAGAGACGCTGTTGTTATGGAAGTCTCTTCTATAGGACTTGCCT
CTGGAAGAGTAGCCTATACCAATTTTGATACAGCAGTTCTGACTAATATT
ACCTTAGATCATCTCGATTTTCATGGCACATTTGAAACCTATGTTGCGGC
GAAAGCCAAGCTTTTCTCTCTCGTGCCCCCTTCGGGAATGGTTGTTATCA
ACACAGACTCTCCCTACGCTTCTCAGTGTATTGAGAGTGCAAAGGCACCG
GTCATCACTTATGGTATAGAGAGTGCTGCTGACTACCGAGCCACCGATAT
CCAACTTTCTTCCTCGGGAACAAAGTATACCTTGGTGTACGGGGACCAAA
AAATTGCGTGCTCTTCCTCATTTATTGGAAAGTACAACGTCTATAACCTA
CTTGCTGCGATCTCTACAGTACATGCAAGTTTGCGTTGCGATCTTGAAGA
TTTGCTAGAAAAGATAGGCTTGTGTCAACCTCCTCCAGGTCGTTTGGATC
CTGTACTTATGGGTCCCTGCCCTGTATATATTGATTATGCACACACCCCC
GATGCTTTAGACAATGTCTTAACAGGATTGCATGAGTTACTTCCTGAGGG
GGGAAGACTGATTGTTGTTTTTGGTTGCGGTGGAGATAGAGATCGCAGTA
AACGGAAGTTGATGGCCCAGGTGGTAGAGCGTTATGGTTTTGCTGTTGTA
ACTTCAGATAACCCTAGGAGCGAGCCTCCTGAAGATATTGTGAATGAAAT
TTGTGATGGGTTTTATTCAAAAAACTATTTCATCGAAATCGACAGAAAAC
AAGCAATTACATATGCTCTGTCTATTGCCTCAGATAGAGATATAGTGTTA
ATAGCGGGAAAAGGGCATGAAGCTTACCAAATATTTAAACACCAAACAGT
TGCGTTCGATGATAAGCAGACTGTTTGTGAGGTACTCGCTTCCTATGTCT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy