Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_1 IGR333 IGR332 IGR334 IGR335 ihfA,himD, - CPn0416 CPn0421 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 ihfA,himD, - CPn0416 CPn0421 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 ihfA,himD, - CPn0416 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 CPn0420 amiA, - CPn0417 accA, - CPn0414 amiA, - CPn0417 accA, - CPn0414 CPn0421 CPn0420
* Calculated from Protein Sequence

Gene ID: CPn0417

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
amiA  

Definition:
probable N-acetylmuramoyl-l-alanine amidase

Gene Start:
463035

Gene Stop:
462241

Gene Length:
795

Molecular Weight*:
29420

pI*:
11.10

Net Charge*:
23.58

EC:
3.5.1.28  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Peptideglycan biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
CPn0417 is similar to TP0247, a predicted N-acetylmuramoyl alanine amidase in T. pallidum: residues 44-242 are 30% similar to 113-345 of TP024. No similarities to M. genitalium or U. urealyticum sequences.




CPn0417 is orthologously related to CT268, a predicted N-acetylmuramoyl-l-alanine amidase: residues 8-241 are 59% similar to CT268.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0860
COG name: N-acetylmuramoyl-L-alanine amidase
Functional Class:  M
The phylogenetic pattern of COG0860 is -----q-CEBRhuj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 121 to 242 (E-value = 2.7e-51) place CPn0417 in the Amidase_3 family which is described as N-acetylmuramoyl-L-alanine amidase (PF01520)

PDB Hit:


Gene Protein Sequence:
MKLTKYLNTKQLRSMISRLFVRYSLPMSKQLSFFALCVLGSHPIFAQTPN
PPQRVRRSEVIFIDPGHGGKDQGTASKELHYEEKSLTLSLALTVQSYLKR
MGYKPQLTRSSDVYVDLGKRVALSNRGQGDVFISIHCNHSSNAAAFGTEV
YFYNGKVGSPTRNRMSEVLGKNILAAMEKNGILKSRGLKTANFVVIRDTS
MPAVLVETGFLSNSRERAALQDARYRMHVAKGIAEGVHNFLSGPSFQKPK
QNIAKIRKPQIQAN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCTTACCAAATATTTAAACACCAAACAGTTGCGTTCGATGATAAG
CAGACTGTTTGTGAGGTACTCGCTTCCTATGTCTAAGCAACTGTCGTTTT
TTGCTTTATGTGTGTTAGGAAGTCACCCGATTTTTGCTCAAACACCGAAT
CCTCCTCAGCGTGTACGACGCAGTGAGGTTATATTTATAGATCCTGGACA
CGGGGGAAAAGATCAAGGCACGGCAAGTAAGGAACTTCATTATGAAGAGA
AGTCCCTGACCCTGTCTCTTGCTTTGACGGTTCAAAGTTACTTAAAGCGG
ATGGGTTATAAACCTCAGCTAACCCGATCTTCTGATGTATACGTTGACTT
AGGGAAACGCGTTGCTTTGTCGAACCGTGGGCAGGGGGATGTCTTTATCA
GCATCCACTGTAATCATTCTTCAAACGCAGCAGCCTTTGGCACCGAAGTA
TATTTTTATAATGGTAAGGTCGGATCTCCGACTAGGAATCGCATGTCAGA
AGTACTGGGAAAAAACATTTTAGCTGCTATGGAAAAAAATGGCATTTTGA
AGTCTCGAGGTTTGAAAACTGCGAACTTTGTTGTGATTAGAGATACTTCT
ATGCCTGCAGTTTTGGTGGAAACCGGGTTTTTATCCAATAGTCGTGAACG
TGCGGCCCTGCAAGATGCTCGCTATCGTATGCATGTAGCGAAAGGCATCG
CCGAGGGAGTTCATAATTTTCTTTCTGGACCTAGTTTTCAGAAACCAAAA
CAGAATATCGCTAAAATACGTAAACCACAGATACAAGCAAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy