Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_1 IGR333 IGR332 IGR334 IGR335 ihfA,himD, - CPn0416 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 CPn0411 ihfA,himD, - CPn0416 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 CPn0411 ihfA,himD, - CPn0416 CPn0415 murE, - CPn0418 pbp2,penA, - CPn0419 msbA, - CPn0413 amiA, - CPn0417 accA, - CPn0414 amiA, - CPn0417 accA, - CPn0414 CPn0411 CPn0412 CPn0412
* Calculated from Protein Sequence

Gene ID: CPn0415

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
461498

Gene Stop:
460218

Gene Length:
1281

Molecular Weight*:
47917

pI*:
7.00

Net Charge*:
-0.05

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0415 is orthologously related to CT266, a Chlamydia-specific hypothetical protein: residues 26-412 are 50% similar to CT266.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
4  
22
non-globular  
215  
266

PDB Hit:


Gene Protein Sequence:
LTLIFVIIIVWCNAFLIKLCVIMGLQSRLQHCIEVSQNSNFDSQVKQFIY
ACQDKTLRQSVLKIFRYHPLLKIHDIARAVYLLMALEEGEDLGLSFLNVQ
QYPSGAVELFSCGGFPWKGLPYPAEHAEFGLLLLQIAEFYEESQAYVSKM
SHFQQALFDHQGSVFPSLWSQENSRLLKEKTTLSQSFLFQLGMQIHPEYS
LEDPALGFWMQRTRSSSAFVAASGCQSSLGAYSSGDVGVIAYGPCSGDIS
DCYYFGCCGIAKEFVCQKSHQTTEISFLTSTGKPHPRNTGFSYLRDSYVH
LPIRCKITISDKQYRVHAALAEATSAMTFSIFCKGKNCQVVDGPRLRSCS
LDSYKGPGNDIMILGENDAINIVSASPYMEIFALQGKEKFWNADFLINIP
YKEEGVMLIFEKKVTSEKGRFFTKMN$

Gene Nucleotide Sequence:  Sequence Viewer
TTGACTCTAATTTTTGTTATTATTATCGTTTGGTGCAATGCTTTTCTGAT
CAAATTGTGCGTGATAATGGGGCTGCAATCCAGGTTACAACATTGTATAG
AAGTGTCCCAGAATTCGAACTTTGATTCACAAGTAAAACAGTTTATCTAT
GCGTGCCAAGATAAGACATTAAGGCAGTCTGTACTCAAGATTTTCCGCTA
CCATCCTTTACTAAAAATTCATGATATTGCTCGGGCCGTCTATCTTTTGA
TGGCCTTAGAAGAAGGCGAGGATTTAGGCTTAAGCTTTTTAAATGTACAG
CAGTACCCTTCAGGTGCTGTAGAACTGTTTTCTTGTGGGGGATTTCCTTG
GAAAGGATTACCTTATCCTGCAGAACATGCGGAATTTGGCCTACTCCTGT
TACAGATCGCAGAGTTTTATGAAGAGAGTCAGGCATACGTCTCTAAAATG
AGTCATTTTCAACAGGCACTCTTTGATCACCAAGGGAGCGTCTTTCCCTC
TCTCTGGAGCCAGGAGAACTCTCGACTCCTAAAAGAAAAGACAACTCTTA
GCCAATCGTTTCTCTTCCAATTAGGAATGCAAATTCACCCAGAATACAGT
CTTGAGGATCCTGCACTAGGGTTCTGGATGCAAAGAACGCGTTCTTCATC
CGCTTTTGTAGCCGCTTCAGGATGTCAAAGTAGCTTGGGAGCGTATTCCT
CAGGGGATGTCGGTGTTATCGCTTATGGACCTTGCTCTGGAGACATTAGT
GATTGTTATTATTTTGGATGTTGTGGAATCGCTAAAGAGTTCGTGTGCCA
AAAATCTCACCAAACTACAGAGATTTCTTTTCTCACCTCTACAGGAAAGC
CTCATCCCAGAAATACGGGATTTTCCTACCTTCGAGATTCCTATGTACAT
CTGCCGATCCGCTGTAAGATCACTATTTCCGACAAGCAATATCGCGTGCA
CGCTGCGTTGGCTGAGGCCACCTCTGCCATGACGTTTTCTATTTTCTGTA
AGGGGAAGAATTGTCAGGTTGTTGACGGCCCTCGCTTGCGCTCCTGTTCC
CTAGATTCTTATAAAGGTCCCGGAAACGACATTATGATTCTTGGGGAAAA
TGACGCAATCAACATTGTTTCTGCAAGTCCCTATATGGAAATTTTTGCTT
TGCAAGGCAAAGAAAAATTTTGGAATGCAGACTTTTTGATTAATATTCCT
TACAAAGAAGAGGGCGTCATGTTAATTTTTGAAAAAAAAGTGACCTCTGA
GAAAGGAAGATTCTTTACGAAGATGAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy