Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_1 IGR333 IGR332 IGR334 IGR335 ihfA,himD, - CPn0416 CPn0415 murE, - CPn0418 msbA, - CPn0413 CPn0409 CPn0411 ihfA,himD, - CPn0416 CPn0415 murE, - CPn0418 msbA, - CPn0413 CPn0409 CPn0411 ihfA,himD, - CPn0416 CPn0415 murE, - CPn0418 msbA, - CPn0413 amiA, - CPn0417 accA, - CPn0414 amiA, - CPn0417 accA, - CPn0414 CPn0411 CPn0412 dnaQ, - CPn0410 CPn0412 CPn0409 dnaQ, - CPn0410
* Calculated from Protein Sequence

Gene ID: CPn0414

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accA  

Definition:
acetyl-CoA carboxylase transferase subunit alpha

Gene Start:
460143

Gene Stop:
459169

Gene Length:
975

Molecular Weight*:
36334

pI*:
6.60

Net Charge*:
-1.61

EC:
6.4.1.2  

Functional Class:
energy metabolism  
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0414 is orthologous to CT265, a predicted acetyl-CoA carboxylase transferase (alpha subunit):
residues 1-324 are 86% similar to CT265. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0825
COG name: Acetyl-CoA carboxylase alpha subunit
Functional Class: I
The phylogenetic pattern of COG0825 is a--kyqvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 146 (E-value = 3.7e-96) place CPn0414 in the ACCA family which is described as Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit (PF03255)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
48

PDB Hit:


Gene Protein Sequence:
MELLPHEKQVVEYEKAIAEFKEKNKKNSLLSSSEIQKLEKRLDKLKEKIY
SDLTPWERVQICRHPSRPRTVNYIEGMCEEFVELCGDRTFRDDPAVVGGF
VKIQGQRFVLIGQEKGCDTASRLHRNFGMLCPEGFRKALRLGKLAEKFGL
PVVFLVDTPGAYPGLTAEERGQGWAIAKNLFELSRLATPVIIVVIGEGCS
GGALGMAVGDSVAMLEHSYYSVISPEGCASILWKDPKKNSEAASMLKMHG
ENLKQFGIIDTVIKEPIGGAHHDPALVYSNVREFIIQEWLRLKDLAIEEL
LEKRYEKFRSIGLYETTSESGPEA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACTTCTTCCACACGAAAAACAAGTAGTTGAATATGAAAAGGCTAT
AGCCGAATTTAAAGAAAAAAATAAGAAAAATTCTCTCTTATCTTCTTCAG
AGATTCAGAAATTGGAAAAGCGTTTAGATAAATTAAAAGAAAAGATCTAT
TCGGATTTGACTCCTTGGGAGCGTGTACAAATATGTCGCCACCCTTCGCG
TCCCCGTACTGTCAACTATATTGAAGGGATGTGTGAGGAGTTTGTCGAGC
TTTGTGGAGATCGCACCTTCCGAGATGATCCCGCAGTTGTTGGTGGCTTT
GTAAAAATCCAGGGTCAGCGTTTTGTCCTTATTGGCCAAGAAAAGGGATG
CGATACAGCGTCACGCCTTCATAGGAACTTCGGTATGTTATGTCCCGAGG
GTTTCAGAAAAGCCCTTCGCTTAGGAAAACTCGCTGAAAAGTTTGGCTTG
CCTGTGGTCTTTCTTGTCGATACCCCAGGAGCATATCCTGGATTGACTGC
TGAAGAGAGAGGACAAGGATGGGCAATTGCCAAAAATCTTTTTGAGCTCT
CAAGACTTGCCACTCCCGTGATTATTGTCGTTATCGGTGAGGGATGTTCA
GGTGGAGCTTTGGGCATGGCTGTAGGTGATTCTGTAGCTATGTTAGAGCA
TTCCTATTATTCTGTAATTTCCCCAGAAGGATGCGCCTCCATTCTTTGGA
AAGATCCTAAGAAAAATAGCGAAGCAGCTTCCATGTTGAAAATGCATGGA
GAAAACTTAAAACAATTTGGCATTATCGATACTGTTATCAAAGAGCCCAT
TGGGGGAGCTCACCACGATCCTGCATTGGTATATAGCAATGTTCGAGAGT
TTATCATCCAAGAGTGGTTACGATTAAAAGATCTAGCTATAGAAGAGCTG
TTGGAGAAACGGTACGAAAAATTTCGCTCTATAGGTCTTTATGAAACTAC
TTCTGAAAGCGGTCCTGAGGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy