Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Arg_1 IGR333 IGR331 IGR332 IGR330 IGR334 ihfA,himD, - CPn0416 CPn0407 CPn0415 murE, - CPn0418 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 ihfA,himD, - CPn0416 CPn0407 CPn0415 murE, - CPn0418 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 ihfA,himD, - CPn0416 CPn0407 CPn0415 msbA, - CPn0413 amiA, - CPn0417 accA, - CPn0414 accA, - CPn0414 murE, - CPn0418 amiA, - CPn0417 CPn0411 CPn0412 dnaQ, - CPn0410 CPn0412 dnaQ, - CPn0410 CPn0409 CPn0408
* Calculated from Protein Sequence

Gene ID: CPn0413

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
msbA  

Definition:
ABC transporter protein

Gene Start:
459203

Gene Stop:
457224

Gene Length:
1980

Molecular Weight*:
73883

pI*:
8.50

Net Charge*:
10.38

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ABC transporter sequences; e.g. residues 1-638 are 67% similar to CT264; residues 125-621 are 26% similar to MG015; residues 129-630 are 25% similar to UU060; residues 120-620 are 30% similar to (Z82044) unidentified transporter-ATP binding [Bacillus subtilis]; residues 124-621 are 31% similar to (L17003) member of super-family of ABC proteins [Francisella tularensis (var. novicida)]; and residues 125-621 are 30% similar to MSBA_ECOLI.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1132
COG name: ABC-type multidrug/protein/lipid transport system, ATPase component
Functional Class:  R
The phylogenetic pattern of COG1132 is ---KYQVCEBRHUJGP--inX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 430-441 and 535-566 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 2e-27.

ProDom Summary:  Protein Domain Search
Residues 217-411 are 23% similar to a defined domain of HEPA_ANASP, defined as: HETEROCYST DIFFERENTIATION ATP-BINDING PROTEIN HEPA. DIFFERENTIATION; ATP-BINDING; TRANSMEMBRANE; INNER MEMBRANE.
Residues 535-577 similar to a defined domain of O46057_DROME, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Possible paralogs in C.pneumoniae in order of similarity include; CPn0280, CPn0683, CPn0248, CPn0723, CPn0201, CPn0202, CPn0191, CPn0348, CPn0231, CPn0542, CPn0023, and CPn0682. Residues 411-619 are 32% similar to CPn0280.

Pfam Summary:  Pfam Search
Residues 86 to 353 (E-value = 4.1e-21) place CPn0413 in the ABC_membrane family which is described as ABC transporter transmembrane region (PF00664)
Residues 425 to 608 (E-value = 2.2e-55) place CPn0413 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
17  
34
transmembrane  
126  
143
transmembrane  
190  
207
transmembrane  
212  
236
transmembrane  
313  
331
transmembrane  
336  
353

PDB Hit:


Gene Protein Sequence:
MKLLLKAVLRHKNHLVILGCSLLAILGLTFSSQMEIFSLGMIAKTGPDAF
LLFGRKESGKLVKVSELSQKDILENWQAISKDSETLTVSDATTYIAEHGK
STASLTSKLSKFVRNYIDVSRFRGLAIFLICVAIFKAVTLFFQRFLGQVV
AIRVSRDLRQDYFKALQQLPMTFFHDHDIGNLSNRVMTDSASIALAVNSL
MINYIQAPITFILTLGVCLSISWKFSILICVAFPIFILPIVVIARKIKNL
AKRIQKSQDSFSSVLYDFLAGVMTVKVFRTEKFAFTKYCEHNNKISALEE
KSAAYGLLPRPLLHTIASLFFAFVVVIGIYKFAIPPEELIVFCGLLYLIY
DPIKKFGDENTSIMRGCAAAERFYEVLNHPDLHSQKEREIEFLGLSNTIT
FENVSFGYQEDKHILKNLSFTLHKGEALGIVGPTGSGKTTLVKLLPRLYE
VSQGKILIDSLPITEYNKGSLRNHIACVLQNPFLFYDTVWNNLTCGKDME
EEAVLEALKRAYADEFILKLPKGVHSVLEESGKNLSGGQQQRLAIARALL
KNASILILDEATSALDAISENYIKNIIGELKGQCTQIIIAHKLTTLEHVD
RVLYIENGQKIAEGTKEELLQTCPEFLKMWELSGTKEYNRVFVPDHKLVA
NPTDMAITT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACTACTTCTGAAAGCGGTCCTGAGGCATAAAAATCATCTCGTTAT
ATTAGGCTGTTCTCTACTCGCAATTTTAGGACTTACCTTTTCATCTCAGA
TGGAGATTTTTTCTTTAGGGATGATTGCTAAAACAGGCCCCGACGCCTTT
TTACTTTTTGGACGTAAGGAATCTGGAAAACTTGTAAAGGTTTCAGAACT
AAGTCAGAAAGATATTTTAGAGAATTGGCAGGCAATTAGTAAGGATTCAG
AGACACTTACAGTCTCTGATGCCACGACATACATCGCCGAACATGGGAAA
AGCACAGCCTCTCTGACGAGCAAGCTCTCTAAGTTTGTCCGTAACTACAT
CGATGTGAGCCGCTTTCGAGGACTGGCAATCTTCTTAATCTGCGTTGCTA
TTTTTAAAGCAGTCACCTTATTTTTCCAACGTTTCCTTGGGCAAGTCGTT
GCTATACGGGTAAGCCGAGACTTACGTCAGGACTACTTTAAGGCCCTACA
ACAACTCCCCATGACCTTCTTCCATGATCATGATATCGGTAATTTAAGTA
ATCGTGTCATGACAGATTCTGCAAGCATTGCCTTAGCAGTAAACTCTTTA
ATGATTAACTACATTCAAGCCCCAATTACCTTCATATTGACATTGGGAGT
CTGTCTGTCGATTTCATGGAAGTTTTCAATTCTTATTTGTGTTGCCTTTC
CTATCTTTATCCTTCCCATTGTCGTGATCGCTAGAAAGATCAAAAATTTA
GCAAAACGTATTCAAAAGAGTCAGGATTCATTTTCCTCCGTTCTTTATGA
TTTTCTTGCTGGGGTTATGACAGTAAAAGTCTTTCGTACAGAAAAATTTG
CCTTCACAAAATATTGTGAGCATAACAATAAGATTTCTGCTTTAGAGGAG
AAAAGTGCTGCTTACGGTTTGCTTCCACGACCCCTCCTGCATACCATAGC
TTCTTTATTTTTTGCTTTTGTCGTCGTTATCGGAATTTATAAATTTGCTA
TTCCTCCCGAAGAACTTATCGTATTTTGTGGTTTGCTCTACCTAATCTAC
GACCCTATTAAGAAGTTCGGGGATGAAAATACCTCCATCATGAGGGGATG
TGCTGCTGCGGAGAGATTTTATGAAGTCTTGAATCACCCCGATCTTCATA
GTCAAAAAGAAAGAGAAATCGAGTTCCTTGGACTTTCTAATACAATCACA
TTCGAGAATGTTTCCTTCGGCTATCAGGAAGATAAGCACATCCTCAAAAA
TCTAAGCTTTACCTTACATAAAGGCGAAGCTCTAGGCATTGTAGGACCTA
CAGGATCTGGAAAAACAACACTTGTTAAATTACTTCCTAGGCTCTACGAA
GTCTCCCAAGGAAAGATTCTTATCGACTCTCTTCCTATTACGGAATATAA
CAAAGGGTCCTTAAGGAATCACATCGCCTGTGTATTACAGAATCCTTTCT
TATTCTATGATACTGTATGGAATAACCTTACCTGTGGTAAGGATATGGAG
GAGGAGGCTGTTTTAGAAGCTCTAAAACGTGCCTACGCTGATGAGTTTAT
TTTAAAGCTCCCTAAAGGAGTCCATAGCGTGCTCGAAGAATCTGGGAAGA
ATCTCTCAGGAGGACAGCAGCAACGTTTGGCAATAGCACGTGCTCTGTTG
AAAAACGCCTCCATCTTAATTTTAGATGAGGCAACGTCAGCTCTAGATGC
CATTAGTGAAAATTACATTAAGAATATCATTGGAGAGCTTAAAGGACAGT
GCACACAAATCATTATTGCCCACAAGCTGACCACTCTTGAACATGTAGAT
CGCGTGCTCTACATAGAAAATGGTCAAAAAATTGCCGAAGGCACAAAAGA
AGAACTCTTACAGACGTGTCCTGAATTTTTAAAAATGTGGGAGCTCTCAG
GGACTAAAGAATATAACAGGGTCTTTGTTCCTGATCACAAATTAGTCGCA
AATCCTACGGACATGGCAATAACAACTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy