Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR333 IGR331 IGR332 IGR329 IGR330 IGR334 ihfA,himD, - CPn0416 CPn0407 CPn0415 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 fabI, - CPn0406 ihfA,himD, - CPn0416 CPn0407 CPn0415 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 fabI, - CPn0406 ihfA,himD, - CPn0416 CPn0407 CPn0415 msbA, - CPn0413 accA, - CPn0414 accA, - CPn0414 CPn0411 fabI, - CPn0406 CPn0412 dnaQ, - CPn0410 CPn0412 dnaQ, - CPn0410 CPn0409 CPn0408
* Calculated from Protein Sequence

Gene ID: CPn0412

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
456590

Gene Stop:
457249

Gene Length:
660

Molecular Weight*:
24675

pI*:
4.60

Net Charge*:
-11.70

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0412 is similar to CT263, a hypothetical protein: residues 9-202 are 36% similar to CT263.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MNAVNTPKKILCIVADYREISPLIEQLDFTQINEHLYSYRCTDYHLDLYI
VHVWGSTAVLNALQSYCQAYTDYDLWINPGFVGACSPEIPLGQCYTIEKI
ANLTTDTPPVLSEDPPYIFDALPDSLPKSSLVTSPVLYHYGFHKTFKLLD
MEGYAIASQAAEHHIPCSFLKITSDYTVPGDCPFSRLEEVSQKLTQTLVE
LLPELMERAIPPKLLLPCP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGCTGTCAATACACCTAAAAAAATCCTTTGCATTGTTGCAGACTA
TAGAGAAATTTCTCCTCTAATTGAACAACTTGATTTTACACAGATCAACG
AGCATCTCTATAGTTATCGTTGTACTGACTACCATCTAGATCTCTATATT
GTCCATGTTTGGGGAAGTACAGCCGTTTTAAATGCTCTTCAAAGCTATTG
CCAAGCATATACAGATTACGATCTGTGGATCAATCCAGGTTTTGTGGGGG
CATGTTCTCCCGAGATTCCTTTAGGTCAATGTTACACTATTGAGAAAATT
GCAAACCTCACTACGGATACACCTCCTGTTCTCTCTGAAGATCCCCCTTA
TATCTTTGACGCTCTACCGGATTCTCTACCTAAAAGCTCTCTGGTTACCT
CTCCAGTATTGTACCATTATGGGTTTCATAAGACGTTTAAACTTCTAGAT
ATGGAAGGCTATGCTATAGCCTCACAAGCAGCAGAACATCACATCCCCTG
TTCTTTTCTCAAGATCACTTCTGATTATACTGTTCCAGGAGACTGTCCCT
TCAGCAGATTGGAGGAGGTATCACAAAAGCTAACTCAGACACTTGTAGAG
TTGTTGCCTGAGCTCATGGAGAGAGCGATCCCACCTAAGTTGTTATTGCC
ATGTCCGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy