Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR331 IGR332 IGR329 IGR330 CPn0405 CPn0407 CPn0415 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 fabI, - CPn0406 CPn0405 CPn0407 CPn0415 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 fabI, - CPn0406 Type: tandem, Name:  - 6 CPn0405 CPn0407 CPn0415 msbA, - CPn0413 accA, - CPn0414 accA, - CPn0414 CPn0411 fabI, - CPn0406 CPn0412 dnaQ, - CPn0410 CPn0412 dnaQ, - CPn0410 CPn0409 CPn0408
* Calculated from Protein Sequence

Gene ID: CPn0411

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
455833

Gene Stop:
456612

Gene Length:
780

Molecular Weight*:
28893

pI*:
9.00

Net Charge*:
7.62

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0411 is similar to several hypothetical proteins in Aquifex aeolicus (AE000683), Archaeoglobus fulgidus (AE000986) and Helicobacter pylori J99 (AE001453).

No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0411 is orthologously related to CT262, a hypothetical protein: residues 1-252 are 52% similar to that of CT262.



COGS Summary:  COGS Search
BeTs to 4 clades of COG2107
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG2107 is a----q------uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 259 (E-value = 1.6e-183) place CPn0411 in the DUF191 family which is described as Uncharacterized ACR, COG2107 (PF02642)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
171  
189

PDB Hit:


Gene Protein Sequence:
MILTAAFSPCPNDIFLFRSFLKDPQFRPLLNQVTIADIETLNTLALQRRL
SLMKMSAALFPLVSDYYNLMDVGNTLGYNSGPIVLSLDPECSLDTLATPG
EMTTAHALCKLYYPKAKLIPMPYDKILSAILQGKVDGGALIHEERFSYDL
QLTLRADFGELWRRKTIFPLPLGCLAIAKYVPMATVDALTAALRKSLICS
LKDPITAGAKAVEYSKNKNVTVIHRFIGTYINKETFQLSKTGKKALHMLW
KANECCQYT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATACTGACTGCTGCCTTTTCTCCTTGCCCGAATGATATTTTCCTTTT
TCGTTCTTTCTTAAAAGACCCCCAATTCAGGCCTCTTCTTAACCAGGTAA
CAATTGCGGATATTGAAACTTTGAATACCCTAGCTCTGCAGCGACGGCTC
TCCCTAATGAAAATGTCAGCAGCGCTCTTCCCTCTAGTTTCTGATTATTA
TAATCTTATGGACGTAGGAAATACCTTAGGATACAACAGCGGTCCTATCG
TCCTCTCCTTAGATCCTGAATGTTCTCTAGATACCTTGGCAACTCCTGGA
GAGATGACAACCGCTCATGCTCTCTGTAAACTTTACTATCCCAAGGCAAA
ACTCATTCCCATGCCTTATGACAAAATTCTATCCGCGATACTGCAAGGGA
AAGTCGATGGAGGCGCTCTGATTCATGAAGAGCGCTTCAGCTACGATCTC
CAATTGACATTGCGGGCAGACTTTGGAGAGCTATGGCGCCGTAAGACCAT
CTTTCCCCTTCCTTTAGGATGTTTAGCCATTGCGAAATATGTTCCTATGG
CTACAGTGGATGCTCTAACAGCAGCATTAAGAAAGTCTTTAATTTGCTCC
CTGAAAGATCCTATAACTGCGGGAGCAAAAGCAGTAGAATACTCTAAAAA
TAAAAACGTGACCGTGATTCATAGATTCATAGGAACCTATATCAACAAAG
AAACCTTTCAACTATCTAAAACTGGGAAAAAAGCTTTACATATGCTCTGG
AAGGCCAATGAATGCTGTCAATACACCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy