Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR331 IGR332 IGR328 IGR329 IGR330 CPn0405 CPn0407 CPn0404 CPn0415 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 fabI, - CPn0406 CPn0405 CPn0407 CPn0404 CPn0415 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 fabI, - CPn0406 Type: tandem, Name:  - 6 CPn0407 CPn0404 msbA, - CPn0413 accA, - CPn0414 CPn0415 CPn0405 accA, - CPn0414 CPn0411 fabI, - CPn0406 CPn0412 dnaQ, - CPn0410 CPn0412 dnaQ, - CPn0410 CPn0409 CPn0408
* Calculated from Protein Sequence

Gene ID: CPn0410

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaQ  

Definition:
DNA polymerase III alpha/epsilon chain

Gene Start:
455123

Gene Stop:
455836

Gene Length:
714

Molecular Weight*:
27048

pI*:
5.60

Net Charge*:
-6.16

EC:
 2.7.7.7  

Functional Class:
DNA metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0410 is similar to TP0643, a predicted DNA polymerase III epsilon chain in T. pallidum and to MG031 in M. genitalium and UU377 in U.urealyticum, both predicted DNA polymerase III alpha chain.

CPn0410 is orthologously related to CT261, a predicted DNA polymerase III alpha/epsilon chain: residues 6-235 are 66% similar to residues 1-230 of CT261. CPn0410 are also similar to CT536, a predicted DNA polymerase III alpha chain.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0847
COG name: DNA polymerase III epsilon subunit (3'-5' exonuclease)
Functional Class:  L
The phylogenetic pattern of COG0847 is a---YQvcEbRHuj---lINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0410 is paralogously related to CPn0655, a predicted DNA polymerase III epsilon chain:residues 13-211 are 32% similar to CPn0655.


Pfam Summary:  Pfam Search
Residues 9 to 164 (E-value = 2.5e-53) place CPn0410 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

PDB Hit:


Gene Protein Sequence:
MSSQTMDVLIFYDTETTGTQIERDRIIEIAAYNSVTDESFLTYVNPEIPI
PDEASKIHGITTDAVLSAPKFPEAYEGFRKFCGEDSILVAHNNDGFDFPL
LGKECRRHSLEPLTNRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQA
HRALDDVVILHKVFTSLIGDLPPQQVLDLLQQSYHPKVFKMPFGKYKGQP
LVDIPKSYFEWLENQGALDKPENKDIKAAIALLHQPT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAGTCAAACTATGGATGTTCTTATTTTCTATGATACGGAGACCAC
AGGAACACAAATAGAAAGAGATCGCATTATAGAAATTGCTGCCTACAATA
GTGTCACAGATGAGTCCTTTCTTACTTATGTGAATCCGGAAATTCCCATT
CCTGATGAGGCATCCAAAATTCATGGAATCACTACGGATGCGGTACTTTC
TGCTCCCAAATTTCCTGAAGCCTACGAGGGATTTAGGAAATTTTGCGGAG
AGGACAGCATCTTAGTGGCTCATAATAATGACGGTTTTGATTTCCCCCTA
CTCGGTAAGGAATGTCGCAGACATTCCTTAGAGCCTCTGACAAACCGTAC
AATAGACTCTCTAAAATGGGCACAAAAATATCGCCCCGATCTACCAAAAC
ATAATTTACAATACCTAAGACAAGTTTACGGTTTTGCTGAAAATCAAGCA
CACCGAGCTCTAGATGACGTAGTGATATTGCACAAGGTATTTACTTCTTT
AATCGGTGATTTACCGCCCCAGCAAGTCCTCGACTTGCTGCAACAGAGCT
ATCACCCGAAAGTCTTCAAAATGCCTTTTGGCAAATACAAAGGGCAGCCT
CTTGTGGATATTCCTAAGTCTTACTTCGAATGGCTGGAAAACCAAGGAGC
TTTGGATAAGCCTGAAAATAAAGACATCAAAGCCGCTATAGCTCTATTAC
ATCAACCGACATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy