Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR331 IGR328 IGR329 IGR330 CPn0405 CPn0407 CPn0404 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 fabI, - CPn0406 CPn0405 CPn0407 CPn0404 msbA, - CPn0413 CPn0408 CPn0409 CPn0411 fabI, - CPn0406 Type: tandem, Name:  - 6 CPn0405 CPn0407 CPn0404 msbA, - CPn0413 accA, - CPn0414 accA, - CPn0414 CPn0411 fabI, - CPn0406 CPn0412 dnaQ, - CPn0410 CPn0412 dnaQ, - CPn0410 CPn0409 CPn0408
* Calculated from Protein Sequence

Gene ID: CPn0409

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
454645

Gene Stop:
455130

Gene Length:
486

Molecular Weight*:
18593

pI*:
4.80

Net Charge*:
-7.94

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0409 is orthologously related to CT260, a hypothetical protein: residues 1-157 are 70% similar to CT260.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MTTWTLNQNNLTKFLKSSDEEPFLERESGLTYINIQANGNELPLFFVIRS
EGEILQLICYLPYQLHESHKASTARLLHLLNRDIDIPGFGMDEEQGLIFY
RLVLPCLNGEIHDTLLRIYIDTIKLVCDSFSHAIGLISSGNMNLDELRRQ
ALQEQQEKRNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGACATGGACATTAAATCAAAATAATCTCACAAAATTTCTTAAAAG
TTCGGATGAAGAACCTTTCTTAGAAAGAGAAAGCGGTCTTACTTACATTA
ACATTCAAGCTAATGGCAATGAACTCCCTTTATTTTTTGTAATCCGCAGT
GAGGGAGAAATACTGCAGTTGATTTGTTACCTTCCCTACCAATTGCATGA
ATCTCATAAGGCATCAACAGCTCGTTTACTCCATCTCTTAAATAGGGACA
TTGATATTCCCGGCTTTGGCATGGATGAAGAACAGGGATTGATATTTTAT
CGGCTTGTGTTGCCCTGCCTAAACGGAGAAATTCATGACACACTATTACG
GATATATATCGATACAATAAAGCTAGTCTGTGATAGTTTTTCTCATGCTA
TTGGGTTGATCTCTTCTGGGAATATGAATTTGGATGAACTAAGACGTCAG
GCTCTTCAAGAGCAACAAGAAAAACGTAATGAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy