Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR326 IGR331 IGR328 IGR327 IGR329 IGR330 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 msbA, - CPn0413 CPn0408 CPn0409 yceC, - CPn0403 CPn0411 fabI, - CPn0406 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 msbA, - CPn0413 CPn0408 CPn0409 yceC, - CPn0403 CPn0411 fabI, - CPn0406 Type: tandem, Name:  - 6 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 msbA, - CPn0413 yceC, - CPn0403 CPn0411 fabI, - CPn0406 CPn0412 dnaQ, - CPn0410 CPn0412 dnaQ, - CPn0410 CPn0409 CPn0408
* Calculated from Protein Sequence

Gene ID: CPn0407

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible HAD superfamily hydrolase/phosphates

Gene Start:
453742

Gene Stop:
452855

Gene Length:
888

Molecular Weight*:
33589

pI*:
5.30

Net Charge*:
-8.20

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0407 is orthologously related to CT103, a conserved hypothetical protein (possible HAD superfamily hydrolase/phosphatase): residues 1-294 are 50% similar to CT103.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0561
COG name: Predicted hydrolases of the HAD superfamily
Functional Class:  R
The phylogenetic pattern of COG0561 is a-tky-vCEBrH--GPOlin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MEKLLVTDIDGTITHQSHHLDKKVYERLYALHQAGWKLFFLTGRYYKYAA
RLFSDFDAPYLLGCQNGASVWSSTSSNLLYSKSLPSDLLCILQDCMEGAT
ALFSVESGAPYGDHYYRFSPTPIAQDLHEYVDPRYFPNAKEREILFETRS
LKDDYAFPSFAAAKVFGLRDEVIRIQKELERQEALTSVATMTLMRWPFDF
RYAILFLTDKSVSKGKALDRVVNILYDGKKPFVMASGDDANDLDLIERGD
FKIVMSSAPEEMHVHADFLAPPADKNGILSAWEAGVRYYDDLMSL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAGTTACTAGTGACTGATATTGACGGTACAATTACCCATCAATC
TCATCATTTAGATAAAAAGGTGTATGAGCGGCTCTATGCGCTGCACCAAG
CTGGTTGGAAGTTGTTTTTCTTGACGGGAAGGTATTATAAATATGCTGCA
CGCTTGTTTTCTGATTTTGATGCTCCATATTTATTAGGATGCCAAAACGG
CGCTTCTGTATGGTCTTCAACATCATCAAATCTTCTCTATTCTAAAAGTT
TACCCTCAGATTTATTATGTATTTTACAAGATTGTATGGAGGGGGCAACG
GCTCTTTTTTCCGTGGAATCAGGAGCTCCTTACGGGGATCACTACTATCG
CTTTTCACCGACTCCTATAGCTCAAGATTTACACGAATATGTAGATCCTA
GGTACTTTCCTAATGCTAAGGAAAGAGAGATCCTATTTGAAACGCGCTCT
TTAAAAGACGACTATGCTTTTCCTAGTTTTGCTGCAGCAAAAGTCTTTGG
ACTGCGAGATGAGGTCATCAGAATTCAAAAGGAGCTGGAACGCCAAGAAG
CACTGACTTCAGTCGCGACGATGACGTTAATGCGCTGGCCCTTTGACTTT
CGCTATGCCATCTTGTTTTTAACAGATAAAAGCGTCTCTAAAGGCAAAGC
CTTAGATCGTGTTGTCAATATACTTTATGATGGAAAGAAACCCTTTGTCA
TGGCTTCAGGAGATGATGCTAATGATCTCGATCTTATTGAGAGAGGAGAT
TTTAAAATTGTGATGAGTTCCGCACCTGAAGAGATGCACGTTCATGCGGA
CTTTCTAGCTCCCCCAGCAGATAAGAATGGCATTCTTTCAGCTTGGGAAG
CTGGTGTCCGCTATTATGACGACCTTATGAGTCTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy