Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR326 IGR331 IGR328 IGR327 IGR324 IGR329 IGR330 CPn0401 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 msbA, - CPn0413 CPn0408 CPn0409 yceC, - CPn0403 CPn0411 fabI, - CPn0406 CPn0401 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 msbA, - CPn0413 CPn0408 CPn0409 yceC, - CPn0403 CPn0411 fabI, - CPn0406 Type: tandem, Name:  - 6 CPn0401 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 msbA, - CPn0413 yceC, - CPn0403 CPn0411 fabI, - CPn0406 CPn0412 dnaQ, - CPn0410 CPn0412 dnaQ, - CPn0410 CPn0409 CPn0408
* Calculated from Protein Sequence

Gene ID: CPn0406

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabI  

Definition:
enoyl-acp reductase

Gene Start:
451969

Gene Stop:
452868

Gene Length:
900

Molecular Weight*:
31976

pI*:
5.50

Net Charge*:
-4.03

EC:
1.3.1.9  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Comment:


Blast Summary:  PSI-Blast Search
CPn0406 is orthologous to CT104, a predicted enoyl-acp reductase: residues
1-298 are 85% similar to CT104. Weaker similar is seen to CT237, a
predicted 3-oxyacyl [acyl-carrier protein] reductase. No similarity to
T.pallidum, M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0623
COG name: Enoyl-[acyl-carrier-protein] reductase (NADH)
Functional Class:  I
The phylogenetic pattern of COG0623 is -----q-cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
Residues 13 to 285 (E-value = 2.3e-05) place CPn0406 in the adh_short family which is described as short chain dehydrogenase (PF00106)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
123  
201

PDB Hit:


Gene Protein Sequence:
MLKIDLTGKVAFVAGIGDDQGYGWGIAKLLAEAGATIIVGTWVPIYKIFS
QSWELGKFNESRKLSNGTLLEIAKIYPMDASFDSPEDVPEDIAENKRYKG
ITGFTISEVAEQVKKDFGHIDILVHSLANSPEISKSLLETSRKGYLAALS
ASSYSFVSLLSHFGSIMNRGGSTISLTYLASMRAVPGYGGGMSSAKAALE
SDTKTLAWEAGRRWGIRVNTISAGPLASRAGKAIGFIERMVDYYQEWAPI
PEAMNAEQVGAVAAFLASPLASAITGETLYVDHGANVMGIGPEMFPKDS$


Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAAAGATTGATCTAACAGGAAAGGTAGCATTTGTTGCGGGCATTGG
TGATGACCAAGGATATGGCTGGGGTATTGCTAAACTTCTTGCAGAAGCAG
GAGCTACGATTATTGTAGGAACATGGGTACCGATTTACAAAATTTTCTCT
CAGTCTTGGGAATTAGGAAAATTCAATGAATCTAGAAAATTATCGAATGG
CACTCTCTTAGAGATTGCTAAGATCTATCCCATGGACGCAAGTTTTGATA
GCCCTGAAGATGTTCCTGAAGATATTGCTGAAAATAAACGTTACAAGGGC
ATTACGGGATTCACGATATCAGAAGTCGCAGAACAGGTAAAAAAAGATTT
TGGTCATATTGACATTCTTGTCCACTCGCTGGCAAATAGTCCTGAAATTT
CTAAGTCTCTATTAGAAACATCAAGAAAAGGTTACTTAGCGGCTCTCAGT
GCCTCTAGTTATTCTTTTGTTAGCCTTCTCTCTCACTTTGGAAGTATCAT
GAACCGTGGTGGATCGACAATATCGCTCACCTATTTGGCTTCTATGCGCG
CTGTTCCTGGATACGGAGGGGGCATGAGTTCGGCAAAAGCAGCTTTGGAA
AGTGACACCAAAACTCTTGCTTGGGAAGCGGGACGCCGTTGGGGCATACG
TGTCAATACCATCTCTGCAGGACCTTTAGCAAGCCGAGCTGGAAAAGCAA
TTGGTTTTATTGAAAGAATGGTAGACTATTACCAAGAGTGGGCGCCTATT
CCCGAGGCTATGAATGCCGAGCAGGTGGGTGCCGTTGCAGCTTTCTTAGC
ATCACCTCTAGCTTCAGCAATTACTGGTGAGACCTTATACGTAGATCACG
GAGCCAATGTGATGGGAATTGGTCCTGAGATGTTCCCTAAAGACTCATAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy