Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR326 IGR331 IGR328 IGR327 IGR324 IGR329 IGR330 CPn0401 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 CPn0408 CPn0409 CPn0399 yceC, - CPn0403 CPn0400 CPn0411 fabI, - CPn0406 CPn0401 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 CPn0408 CPn0409 CPn0399 yceC, - CPn0403 CPn0400 CPn0411 fabI, - CPn0406 Type: tandem, Name:  - 6 CPn0401 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 yceC, - CPn0403 CPn0400 fabI, - CPn0406 dnaQ, - CPn0410 CPn0409 CPn0411 CPn0399 dnaQ, - CPn0410 CPn0408
* Calculated from Protein Sequence

Gene ID: CPn0405

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
451739

Gene Stop:
450963

Gene Length:
777

Molecular Weight*:
25354

pI*:
4.40

Net Charge*:
-3.64

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0405 is weakly similar to CT105, a Chlamydia-specific hypothetical protein: residues 36-245 are 26% similar to residues 128-350 of CT105.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
258

PDB Hit:


Gene Protein Sequence:
LGFTDYLGGCLTNPLGKFPSPQNPQVVTIAPSSTTPQAVSSAVQGFLQTG
GAASSTATTTTASGASALGLSPDQVQALLTNLLNVGQPSVGQPSTSAGTS
GASSSSASMQQQLLQLILDKTTGSGGSSVSSEQLQQLLSLVSQMTTSQGG
SGGTQAGQAASVLLNLLSATGSAAANPLGTAASLAQIIYAAVTSPGAKKT
SEFCYNYCGETCQGNCGCPTCGCPDGQCGCGGFGRFFCGVWKNCCGIGEG
SQEPAIPL$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGGTTTCACTGATTACTTAGGAGGTTGTTTGACGAATCCTTTAGGGAA
ATTCCCCTCACCACAGAATCCACAGGTTGTTACGATAGCGCCTTCTTCCA
CAACACCACAAGCAGTCTCATCTGCAGTTCAAGGTTTTCTTCAAACTGGA
GGAGCTGCCTCCTCTACAGCGACAACTACTACCGCATCCGGAGCCTCTGC
ATTAGGACTTTCACCTGATCAAGTGCAAGCGTTGCTTACTAATTTATTAA
ATGTGGGACAACCATCAGTGGGACAACCATCAACTTCAGCAGGAACTTCG
GGAGCCTCCTCTTCCAGTGCAAGTATGCAGCAACAGCTTTTGCAACTTAT
CTTAGACAAGACAACAGGAAGTGGCGGATCGTCCGTGAGTTCAGAGCAAT
TACAGCAACTCCTTAGCTTGGTGAGCCAGATGACTACGTCTCAAGGAGGA
AGTGGTGGAACTCAGGCAGGACAGGCCGCTTCGGTACTGTTGAATTTGTT
ATCGGCAACAGGATCTGCAGCAGCAAATCCTTTAGGGACAGCTGCATCGT
TGGCACAGATCATTTATGCAGCAGTAACAAGTCCTGGAGCAAAGAAAACT
AGCGAATTTTGTTATAATTATTGTGGAGAGACCTGCCAAGGCAACTGCGG
TTGTCCTACCTGTGGCTGTCCAGACGGACAGTGCGGTTGTGGAGGATTTG
GCCGTTTTTTCTGTGGTGTATGGAAAAATTGTTGCGGGATAGGAGAGGGA
TCCCAAGAACCCGCAATCCCTTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy