Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR326 IGR320 IGR328 IGR327 IGR322 IGR324 IGR329 IGR330 IGR321 CPn0401 CPn0397 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 CPn0398 CPn0408 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 CPn0401 CPn0397 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 CPn0398 CPn0408 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 Type: tandem, Name:  - 6 CPn0401 CPn0397 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 CPn0408 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 CPn0398
* Calculated from Protein Sequence

Gene ID: CPn0403

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yceC  

Definition:
yceC, predicted pseudouridine synthetase family

Gene Start:
449015

Gene Stop:
449713

Gene Length:
699

Molecular Weight*:
26530

pI*:
10.70

Net Charge*:
17.48

EC:
4.2.1.70  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
From SwissProt (P23851):
[FUNCTION] the ribosomal large subunit PSEUDOURIDINE SYNTHASE C (PSEUDOURIDYLATE SYNTHASE) (URACIL HYDROLYASE)is RESPONSIBLE FOR SYNTHESIS OF PSEUDOURIDINE FROM URACIL
AT POSITIONS 955, 2504 AND 2580 IN 23S RIBOSOMAL RNA.
[SIMILARITY] BELONGS TO THE RLU FAMILY OF PSEUDOURIDINE SYNTHASES.

Blast Summary:  PSI-Blast Search
CPn0403 is orthologously related to CT106: residues 15-193 of CPn0403 are 51% similar to residues 1-177 of CT106, a predicted ribosomal large subunit pseudouridine synthase C (pseudouridylate synthase) (uracil hydrolyase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0564
COG name: Predicted pseudouridylate synthase family 2
Functional Class:  J
The phylogenetic pattern of COG0564 is ----YqVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 26 to 73 (E-value = 7.1e-08) place CPn0403 in the S4 family which is described as S4 domain (PF01479)
Residues 92 to 213 (E-value = 1.4e-12) place CPn0403 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

PDB Hit:


Gene Protein Sequence:
MQLSNDKRAALQYFMENFSWLATQVSRLSSFLRSQLPNHSKQEILASIRQ
HRCRVNGFIERFESYKVQPGDRVSLSLIPSTKQQPSILWEDDYSIIYEKP
PHLTTEQMAHMTRFFTVHRLDKGTSGCLLMGKSKQAATELMKLFKQRKIH
KQYIAFVFGHPKKKFGTVKSYTAPVYRRCGAVIFGAAGPSQGEPIKSAYK
WDCWVILLSEMSTTDLKNSLPRSSALSSMLTP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTATCAAATGATAAAAGGGCTGCTTTACAATATTTTATGGAAAA
TTTTTCCTGGCTTGCCACACAAGTCTCAAGATTATCTTCTTTTCTTAGAT
CTCAACTGCCTAATCATAGCAAGCAAGAAATCTTGGCGTCTATTCGCCAA
CATCGATGTCGAGTGAACGGGTTCATAGAAAGATTTGAATCCTACAAGGT
ACAACCTGGCGACCGTGTTTCCCTATCTCTGATCCCCTCAACAAAACAAC
AACCTAGCATCCTCTGGGAGGATGACTATAGCATTATCTACGAAAAACCT
CCCCATCTTACTACTGAACAAATGGCACACATGACACGGTTTTTTACTGT
GCATAGGTTAGACAAAGGCACCTCTGGGTGTCTTCTCATGGGAAAGTCTA
AACAAGCGGCTACTGAGCTCATGAAATTGTTCAAGCAAAGAAAAATCCAT
AAACAATACATAGCTTTCGTTTTTGGTCATCCTAAAAAAAAATTTGGAAC
CGTAAAATCTTATACGGCCCCCGTATACCGGAGGTGTGGAGCTGTGATTT
TTGGAGCCGCAGGCCCATCACAGGGAGAACCCATCAAATCCGCTTACAAA
TGGGATTGCTGGGTCATCCTATTGTCGGAGATGTCGACTACGGACCTAAA
GAACAGCCTCCCCAGATCTTCCGCCCTCTCCTCCATGCTCACTCCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy