Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR326 IGR320 IGR328 IGR327 IGR322 IGR324 IGR329 IGR321 CPn0401 CPn0397 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 CPn0401 CPn0397 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 Type: tandem, Name:  - 6 CPn0401 CPn0397 CPn0405 CPn0407 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 CPn0398
* Calculated from Protein Sequence

Gene ID: CPn0402

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mutY  

Definition:
A/G-specific adenine glycosylase

Gene Start:
448994

Gene Stop:
447885

Gene Length:
1110

Molecular Weight*:
42260

pI*:
8.90

Net Charge*:
8.87

EC:
4.2.99.18  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
Attacks G-A and C-A mispairs in DNA.

Blast Summary:  PSI-Blast Search
CPn0402 is similar to TP0343, a predicted A/G-specific adenine glycosylase in T. pallidum.

CPn0402 is orthologously related to CT107:
residues 1-356 are 52% similar to residues
1-353 of CT107.


COGS Summary:  COGS Search
BeTs to 6 clades of COG1194
COG name: A/G-specific DNA glycosylase
Functional Class:  L
The phylogenetic pattern of COG1194 is --t-----ebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 42 to 176 (E-value = 1.4e-21) place CPn0402 in the HhH-GPD family which is described as HhH-GPD superfamily base excision DNA repair protein (PF00730)
Residues 106 to 135 (E-value = 2.3e-05) place CPn0402 in the HHH family which is described as Helix-hairpin-helix motif (PF00633)

PDB Hit:


Gene Protein Sequence:
MTKIAFSEKAKNFPVEALKKWFEKNKRSLPWRDNPTPYSVWVSEVMLQQT
RAEVVIDYFNQWMERFPTIESLAAAKEEDVIKLWEGLGYYSRARHLLEGA
RMVMEEFHGKIPDDAISLAQIRGVGPYTVHAILAFAFKRRAAAVDGNVLR
VLSRIFLIETSIDLESTRTWVSRIAQALLPHKSPEVIAEALIELGACICK
KVPQCHRCPVRQACGAWRENKQFVLPVRHARKKVIFLHRLVAIVLYDGSL
VVEKRRPKEMMAGLYEFPYIEVEPEEGLQDIEGFTKKMELSLESPLEFLG
NLKEQRHAFTNHKVHLCPIIFKATSLPQFGELHLLSDIDHLAFSSGHKKI
KDALLIYLGDVRSRESIGV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAAGATAGCTTTTTCTGAAAAGGCAAAGAATTTTCCTGTAGAGGC
ATTAAAAAAATGGTTTGAAAAAAATAAACGATCTCTTCCTTGGAGAGATA
ACCCGACTCCCTATAGTGTGTGGGTTTCCGAAGTTATGCTACAGCAAACG
CGAGCTGAAGTTGTTATAGATTATTTTAATCAGTGGATGGAGAGATTTCC
TACCATAGAGTCTTTAGCTGCAGCAAAAGAAGAAGATGTCATTAAGTTAT
GGGAGGGATTGGGTTATTATTCTCGAGCGCGCCATCTTTTAGAGGGAGCT
CGCATGGTTATGGAGGAGTTTCATGGAAAGATCCCTGATGATGCCATTTC
CTTAGCTCAAATTCGTGGAGTTGGTCCTTATACGGTTCATGCTATTCTAG
CCTTTGCTTTTAAGAGGCGTGCTGCTGCTGTGGATGGCAATGTCTTGCGT
GTTCTTAGCCGGATATTTTTGATAGAAACTTCTATAGACTTAGAATCAAC
TCGTACTTGGGTTTCTAGGATTGCTCAAGCGCTTCTTCCTCATAAGAGTC
CCGAGGTTATAGCTGAGGCTCTGATAGAGTTGGGAGCTTGTATCTGTAAA
AAAGTTCCTCAATGTCATCGTTGTCCTGTCCGTCAAGCATGTGGAGCTTG
GAGGGAGAACAAACAGTTCGTATTGCCGGTACGTCATGCCAGAAAAAAGG
TCATCTTTTTGCATCGTTTGGTAGCGATTGTATTGTACGATGGCTCTTTG
GTTGTCGAGAAGAGACGTCCTAAAGAAATGATGGCAGGCTTATATGAATT
TCCTTATATTGAAGTTGAACCAGAGGAAGGTCTTCAAGATATAGAAGGAT
TTACTAAGAAGATGGAGCTTTCTTTAGAAAGCCCTTTGGAATTCTTAGGT
AACCTTAAAGAACAGCGGCATGCGTTTACTAATCATAAGGTTCATTTGTG
TCCTATAATTTTTAAAGCCACTTCTCTGCCTCAGTTCGGGGAATTGCATC
TTTTGAGTGATATAGATCACTTAGCTTTTTCTTCAGGACACAAAAAGATT
AAAGATGCTTTGCTAATCTACCTCGGGGATGTCAGGTCTAGAGAATCAAT
AGGAGTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy