Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR326 IGR320 IGR319 IGR328 IGR327 IGR322 IGR324 IGR329 IGR321 CPn0401 CPn0397 CPn0405 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 CPn0395 CPn0401 CPn0397 CPn0405 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 CPn0395 Type: tandem, Name:  - 6 CPn0401 CPn0397 CPn0405 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0399 yceC, - CPn0403 CPn0400 fabI, - CPn0406 CPn0395 CPn0398
* Calculated from Protein Sequence

Gene ID: CPn0401

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
447884

Gene Stop:
447492

Gene Length:
393

Molecular Weight*:
14741

pI*:
4.90

Net Charge*:
-7.17

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0401 is weakly similar to TP0778, a predicted beta-lactamase regulatory homolog in T. pallidum. No similarities to M. genitalium or U. urealyticum sequences.

CPn0401 is orthologously related to CT255, a conserved hypothetical protein and they share 48% similarity.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1694
COG name: Uncharacterized ACR, MazG family
Functional Class:  S
The phylogenetic pattern of COG1694 is A--K-qVceBrh-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 28 to 102 (E-value = 5.1e-24) place CPn0401 in the MazG family which is described as MazG nucleotide pyrophosphohydrolase domain (PF03819)

PDB Hit:


Gene Protein Sequence:
MRDHAFSKLIGTVRAMVVEGRCPWSLQQSLVSMVEHILGECQEFHEAVLQ
GKTVQEVGSEAGDVLTLVLILCFLLEREGVLASEDVANEAMEKLRRRAPY
IFAEDYKPVSIEEADRLWELAKHREKNEST$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAGATCACGCTTTTTCTAAATTGATAGGGACTGTCCGTGCCATGGT
AGTTGAAGGACGTTGTCCTTGGTCACTTCAGCAATCCCTAGTCTCTATGG
TAGAGCATATTCTTGGAGAGTGTCAGGAATTTCACGAGGCCGTCTTACAA
GGTAAGACGGTACAAGAGGTTGGTTCCGAAGCCGGGGATGTCTTAACTTT
AGTTCTAATTTTATGTTTTCTGTTAGAACGAGAGGGCGTACTTGCTTCCG
AAGACGTTGCCAATGAGGCTATGGAAAAATTGCGTCGCCGTGCTCCTTAT
ATATTCGCTGAAGATTACAAGCCGGTCTCGATTGAAGAGGCCGATCGCCT
TTGGGAGCTTGCTAAGCACCGAGAGAAAAATGAATCTACATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy