Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR326 IGR320 IGR319 IGR328 IGR327 IGR322 IGR324 IGR329 IGR321 CPn0401 CPn0397 CPn0405 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0401 CPn0397 CPn0405 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 Type: tandem, Name:  - 6 CPn0401 CPn0397 CPn0405 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0399 yceC, - CPn0403 CPn0400 CPn0395 tlyC_1, - CPn0394 CPn0398 CPn0395
* Calculated from Protein Sequence

Gene ID: CPn0400

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
446536

Gene Stop:
447309

Gene Length:
774

Molecular Weight*:
28495

pI*:
10.70

Net Charge*:
9.38

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0400 is orthologously related to CT254, a hypothetical protein: residues 5-256 are 42% similar to CT254. CPn0400 is weakly similar to D90914, a hypothetical protein in Synechocystis sp.


COGS Summary:  COGS Search
BeTs to 3 clades of COG1266
COG name: Predicted membrane protein
Functional Class:  S
The phylogenetic pattern of COG1266 is --T--qvC-BR-----o-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 159 to 254 (E-value = 1.8e-32) place CPn0400 in the Abi family which is described as CAAX amino terminal protease family (PF02517)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
14
transmembrane  
37  
54
transmembrane  
65  
83
transmembrane  
107  
126
transmembrane  
154  
171
transmembrane  
193  
217
transmembrane  
239  
256

PDB Hit:


Gene Protein Sequence:
MSKFILLLSLGVAALASKNFFIWPAPSGKTPLKLRQVLFGGALLVFSSLV
ALSVSSQTAELLSTMTGISLAFAFLFYLLFLPKDITRAILFSGERPVKTS
WRALGSAIRMWIIIIPVTQLIGIMMSKFLTLVLPTQEIHTQEVTQEVQNS
LPITGHYISMILNLGVLTPFGEEVFFRGILQTFLKNKMTRIAAVLCSSII
FSFIHIEHSLGSWVFVPVLFVFSLSAGFLYEKDRHILSPIALHGLFNLTS
LLFLGIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCAAGTTTATTCTTCTCTTGTCCCTTGGCGTCGCTGCTCTAGCTTC
CAAAAACTTCTTTATCTGGCCAGCACCCTCTGGGAAAACACCTTTAAAGC
TCCGCCAAGTTTTATTTGGTGGTGCTCTTCTTGTTTTTTCTTCCCTTGTA
GCTCTTAGCGTGAGCTCACAAACTGCGGAATTACTTTCCACCATGACAGG
AATTAGCCTTGCCTTTGCATTTCTGTTCTACCTGCTTTTTCTCCCCAAGG
ATATCACACGTGCTATACTTTTCTCTGGAGAAAGACCGGTTAAAACTTCA
TGGCGTGCTCTAGGATCTGCCATCAGAATGTGGATCATCATCATCCCAGT
AACACAACTGATTGGGATTATGATGAGTAAATTTTTAACTTTGGTTCTTC
CTACGCAAGAGATTCACACACAAGAAGTCACTCAAGAAGTTCAGAACTCT
CTGCCTATAACAGGACACTACATTAGCATGATTCTAAATTTAGGCGTCCT
CACTCCATTTGGAGAAGAGGTATTTTTTAGAGGAATTCTACAGACATTCT
TGAAAAACAAAATGACGCGCATAGCTGCGGTACTATGCTCTTCTATTATT
TTCTCTTTCATTCACATTGAACACTCTTTAGGAAGTTGGGTCTTTGTCCC
CGTGCTCTTTGTTTTTTCCTTATCTGCAGGGTTTCTATATGAAAAAGATC
GGCACATTCTTTCTCCCATTGCACTGCACGGGTTGTTTAACCTCACCTCA
TTGCTATTTTTGGGAATAAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy