Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR326 IGR320 IGR319 IGR328 IGR327 IGR322 IGR324 IGR321 CPn0401 CPn0397 CPn0405 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0401 CPn0397 CPn0405 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0401 CPn0397 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0405 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0395 CPn0395 CPn0398
* Calculated from Protein Sequence

Gene ID: CPn0399

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (basic)

Gene Start:
445879

Gene Stop:
446526

Gene Length:
648

Molecular Weight*:
24214

pI*:
9.20

Net Charge*:
6.02

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0399 is orthologously related to CT253: residues 1-215 are CPn0399 are 64% similar to residues 1-215 of CT253, a predicted hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
20

PDB Hit:


Gene Protein Sequence:
MRKMLVLLASLGLLSPTLSSCTHLGSSGSYHPKLYTSGSKTKGVIAMLPV
FHRPGKSLEPLPWNLQGEFTEEISKRFYASEKVFLIKHNASPQTVSQFYA
PIANRLPETIIEQFLPAEFIVATELLEQKTGKEAGVDSVTASVRVRVFDI
RHHKIALIYQEIIECSQPLTTLVNDYHRYGWNSKHFDSTPMGLMHSRLFR
EVVARVEGYVCANYS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAAAAATGTTGGTATTATTGGCATCTTTAGGACTTCTATCCCCAAC
CCTATCCAGCTGCACTCACTTAGGCTCTTCAGGAAGTTATCATCCTAAGC
TATACACTTCAGGGAGCAAAACTAAAGGTGTGATTGCGATGCTTCCTGTA
TTTCATCGCCCAGGAAAGAGTCTTGAACCTTTACCTTGGAACCTCCAAGG
AGAATTTACTGAAGAGATCAGCAAAAGGTTTTATGCTTCGGAAAAGGTCT
TCCTGATCAAGCACAATGCTTCACCTCAGACAGTCTCTCAGTTCTATGCT
CCGATTGCGAATCGTCTACCCGAAACAATTATTGAGCAATTTCTTCCTGC
AGAATTCATTGTTGCTACAGAACTGTTAGAACAAAAGACAGGGAAAGAAG
CAGGTGTCGATTCTGTAACAGCGTCTGTACGTGTTCGCGTTTTTGATATC
CGTCATCATAAAATAGCTCTCATTTATCAAGAGATTATCGAATGCAGCCA
GCCTTTAACTACCCTAGTCAATGATTATCATCGCTATGGCTGGAACTCAA
AACATTTTGATTCAACGCCCATGGGCTTAATGCATAGCCGTCTTTTCCGC
GAAGTTGTTGCCAGAGTTGAGGGCTATGTTTGTGCTAACTACTCGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy