Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR318 IGR326 IGR320 IGR319 IGR327 IGR322 IGR324 IGR321 CPn0401 CPn0397 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0393 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0401 CPn0397 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 CPn0393 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0401 CPn0397 CPn0404 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0395 CPn0395 CPn0398 CPn0393
* Calculated from Protein Sequence

Gene ID: CPn0398

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
445533

Gene Stop:
445703

Gene Length:
171

Molecular Weight*:
6264

pI*:
6.50

Net Charge*:
-0.07

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
13  
32

PDB Hit:


Gene Protein Sequence:
MQIENSSILFAEVVMKWFIFSVISAPVVFLPGCTLIPKEKVTKVPSQLWS
ESLSQP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAATAGAAAATAGTAGTATTCTTTTTGCAGAGGTAGTCATGAAGTG
GTTTATTTTTTCTGTGATCTCAGCTCCAGTTGTATTCCTCCCAGGGTGCA
CATTGATTCCTAAAGAAAAAGTTACCAAAGTTCCCTCACAACTTTGGTCA
GAATCCCTTTCTCAACCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy