Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR318 IGR323 IGR326 IGR320 IGR319 IGR317 IGR327 IGR322 IGR324 IGR321 CPn0401 CPn0397 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0401 CPn0397 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0401 CPn0397 mutY, - CPn0402 yfhO,nifS, - CPn0396 dcd, - CPn0392 CPn0399 yceC, - CPn0403 CPn0400 tlyC_1, - CPn0394 CPn0393 CPn0395 CPn0395 CPn0393 CPn0398
* Calculated from Protein Sequence

Gene ID: CPn0397

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable protein phosphatase

Gene Start:
445115

Gene Stop:
444378

Gene Length:
738

Molecular Weight*:
27857

pI*:
4.90

Net Charge*:
-8.92

EC:
 

Functional Class:
protein fate; protein modification and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to protein phosphatase sequences; e.g. residues 5-244 are 35% similar to (Z70722) probable phosphoprotein phosphatase [Mycobacterium leprae]; residues 12-244 are 30% similar to (AL079308) putative protein phosphatase [Streptomyces coelicolor]; residues 5-245 are 27% similar to PPH_MYCPN; residues 2-245 are 61% similar to CT259; residues 2-245 are 29% similar to MG108; and residues 8-242 are 23% similar to UU215.
CPn0397 is similar to CT259, a probable protein phosphatase. Residues 2-245 are 61% similar to CT259. No significant similarity to T.pallidum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0631
COG name: Protein serine/threonine phosphatases
Functional Class: T
The phylogenetic pattern of COG0631 is ----YQ-C-br---gp--in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 30-39, 119-158, and 233-242 represent blocks BL01032C,F,and I (Protein phosphatase 2C proteins) with a combined E-value of 2.8e-05.

ProDom Summary:  Protein Domain Search
Residues 9-165 are 36% similar to a defined domain of P73626_XXXXX, defined as: PROTEIN PUTATIVE PHOSPHATASE HYDROLASE YLOO CY10H4.18C TRANSMEMBRANE PHOSPHOPROTEIN.
Residues 166-244 are 41% similar to a defined domain of O34779_BACSU, defined as: PROTEIN PHOSPHATASE MAGNESIUM 2C HYDROLASE MANGANESE MULTIGENE FAMILY CYCLASE PP2C.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 237 (E-value = 7.7e-05) place CPn0397 in the PP2C family which is described as Protein phosphatase 2C (PF00481)

PDB Hit:


Gene Protein Sequence:
VDFDYFGLSDIGRVRARNEDFWQVNLMSQVVAIADGVGGRLGGDIASQEA
VTSLMELIDEQQSKLMGYGDDQYKETLKKILLEVNGVVYEHGQMEEHLQG
MGTTLSFIQFRKDRAWLFHVGDSRIYRIREGELRRLTEDHSLENQLKNRY
GLPKQSDKVYSYRHILTNVLGSRPYVMPDIRNLPCEKEDLYCLCSDGLTN
MVPDIDIRDILNQPATLEERGNALISLANTRGGDDNATVVLVRIQ$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGATTTTGATTATTTTGGTCTGAGTGATATTGGTAGGGTGCGCGCTAG
AAATGAAGATTTTTGGCAGGTAAACCTCATGTCTCAAGTGGTTGCTATTG
CTGACGGTGTTGGGGGGCGTCTTGGTGGAGACATTGCTTCTCAAGAGGCA
GTGACTAGCCTTATGGAGCTGATTGATGAGCAACAGTCAAAATTGATGGG
GTATGGGGATGACCAGTATAAGGAGACTTTAAAAAAGATCCTTTTAGAGG
TCAATGGTGTGGTCTATGAACACGGCCAAATGGAAGAGCATCTCCAGGGT
ATGGGAACCACTCTTAGCTTCATCCAATTCCGGAAGGATAGGGCATGGCT
ATTTCATGTGGGAGATAGTCGAATTTATCGTATTCGTGAGGGAGAACTGC
GCCGCCTTACCGAAGACCATTCTTTAGAAAATCAATTAAAAAATCGTTAT
GGGCTTCCTAAACAATCAGATAAGGTGTATTCTTATCGCCATATTCTGAC
TAATGTTTTGGGAAGTCGTCCCTATGTCATGCCTGACATTCGGAATCTTC
CTTGTGAAAAGGAAGATTTGTACTGCCTCTGTTCGGATGGATTGACAAAC
ATGGTTCCAGATATCGATATTCGTGATATCTTGAACCAGCCCGCCACCCT
AGAAGAACGGGGGAATGCATTAATTTCTCTAGCCAATACTCGTGGAGGCG
ATGACAACGCTACTGTCGTATTAGTCCGAATACAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy