Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR318 IGR320 IGR319 IGR317 IGR322 IGR324 IGR316 IGR321 CPn0391 CPn0401 CPn0397 ruvB, - CPn0390 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 CPn0399 CPn0400 tlyC_1, - CPn0394 CPn0391 CPn0401 CPn0397 ruvB, - CPn0390 mutY, - CPn0402 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 CPn0399 CPn0400 tlyC_1, - CPn0394 CPn0391 CPn0401 CPn0397 ruvB, - CPn0390 mutY, - CPn0402 yfhO,nifS, - CPn0396 dcd, - CPn0392 CPn0399 CPn0400 tlyC_1, - CPn0394 CPn0393 CPn0395 CPn0395 CPn0393 CPn0398
* Calculated from Protein Sequence

Gene ID: CPn0396

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yfhO  nifS  

Definition:
NifS-like aminotransferase

Gene Start:
444353

Gene Stop:
443238

Gene Length:
1116

Molecular Weight*:
40229

pI*:
6.80

Net Charge*:
-1.80

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:
The NIFS proteins are pyridoxal phosphate-dependent aminotransferases,
the function of which is unclear; they can be involved in tRNA processing.

Blast Summary:  PSI-Blast Search
CPn0396 is orthologously related to CT258: residues 2-369 of CPn0396 are 59% similar to residues 3-371 of CT258, a predicted NifS-like aminotransferase from C. trachomatis.
CPn0396 is also similar to TP0863, a predicted nitrogen fixation protein homolog (aminotransferase) from T. pallidum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1104
COG name: Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes (NifS family)
Functional Class:  E
The phylogenetic pattern of COG1104 is A--kYQvCeBRHuj---lINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 10 to 357 (E-value = 5.8e-32) place CPn0396 in the Aminotran_5 family which is described as Aminotransferase class-V (PF00266)

PDB Hit:


Gene Protein Sequence:
MIYLDNNAMTPPERGLLEFLQKTFLIEGTYANPSSVHQLGKKSRQLVLEA
SHWMQKVLSFQGRVLYTSGATESLNLAIASLPKDSHVITSGSEHPAILEP
LKHSSLSVSYLNPEEGRCVLTIEQIERAVTPKTSAIILGWVNSETGAKAD
IAAIAHFAQERQLQFIVDATANVGKERIVLPSGVTMAAFSGHKFHALSGI
GALLVSPGVKLHPQLWGGGQQGGLRAGTENLWGIASLLYIFKYLDLHQER
ISQEILTHRNGFEKAIKARIPDVHIHCADQPRANNVSAIAFPPLEGEVLQ
IALDIEGVACGYGSACSSGATAPFKSLVSMGVDEELTLATLRFSFSHLLL
QEDVERAVGIIEKVVERLKNS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCTATTTGGATAACAATGCGATGACACCCCCAGAGAGGGGACTTTT
GGAATTTCTCCAAAAAACCTTCCTTATAGAAGGGACGTACGCGAATCCTT
CGAGCGTCCATCAATTAGGTAAAAAATCTCGTCAACTGGTTCTAGAAGCT
TCACACTGGATGCAAAAGGTCCTTTCGTTTCAGGGCCGTGTCCTCTATAC
CTCAGGGGCTACTGAGAGTTTAAATTTAGCAATAGCAAGCCTCCCTAAAG
ACAGTCATGTTATCACCTCAGGTAGCGAACACCCCGCCATCTTAGAGCCT
TTAAAACATTCCTCGCTTTCCGTTTCTTATTTAAATCCCGAAGAAGGGAG
ATGTGTTCTTACTATAGAGCAGATTGAAAGAGCTGTGACTCCTAAAACTT
CAGCAATCATCTTAGGTTGGGTCAATAGTGAGACTGGTGCCAAAGCTGAT
ATAGCTGCTATAGCCCACTTCGCGCAAGAACGACAATTGCAATTTATTGT
GGATGCGACTGCAAATGTAGGTAAGGAGAGGATAGTTCTTCCCTCTGGTG
TCACTATGGCAGCATTCAGTGGACATAAATTTCATGCACTCTCTGGAATC
GGAGCTCTTCTGGTCTCTCCAGGAGTCAAACTACATCCTCAGCTGTGGGG
AGGAGGTCAGCAAGGAGGGCTGCGCGCAGGCACAGAAAATCTTTGGGGAA
TCGCCTCTCTGCTTTATATTTTCAAATACCTAGATCTTCATCAAGAGCGT
ATCTCTCAGGAAATTCTTACCCATAGAAATGGTTTTGAAAAGGCAATCAA
AGCACGCATTCCTGATGTCCATATTCATTGTGCGGATCAACCACGGGCAA
ACAACGTCTCAGCAATTGCTTTCCCTCCGTTGGAAGGTGAGGTATTGCAA
ATCGCCTTAGATATAGAAGGAGTGGCTTGTGGTTATGGATCCGCATGCTC
TTCAGGTGCTACCGCACCCTTTAAATCTCTTGTCAGCATGGGTGTTGATG
AAGAGTTGACCCTGGCAACACTCAGGTTTTCTTTTAGCCATCTTCTCTTG
CAAGAAGATGTTGAAAGAGCCGTTGGAATTATAGAAAAAGTCGTAGAACG
TTTGAAAAATTCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy