Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR323 IGR318 IGR320 IGR319 IGR317 IGR322 IGR324 IGR316 IGR321 CPn0391 CPn0401 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 CPn0399 CPn0400 tlyC_1, - CPn0394 CPn0391 CPn0401 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 CPn0399 CPn0400 tlyC_1, - CPn0394 CPn0391 CPn0401 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0389 CPn0389 dcd, - CPn0392 CPn0399 CPn0400 tlyC_1, - CPn0394 CPn0393 CPn0395 CPn0395 CPn0393 CPn0398
* Calculated from Protein Sequence

Gene ID: CPn0395

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (CBS domain)

Gene Start:
441964

Gene Stop:
443178

Gene Length:
1215

Molecular Weight*:
45866

pI*:
9.80

Net Charge*:
11.65

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0395 is similar to TP0027 in T. pallidum, MG146 in M. genitalium and UU072 in U. urealyticum. They are all predicted hemolysin-like proteins.

CPn0395 is orthologously related to CT257, a conserved hypothetical protein: residues 2-403 are 65% similar to residues 3-404 of CT257.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1253
COG name: Uncharacterized CBS domain-containing proteins
Functional Class:  R
The phylogenetic pattern of COG1253 is -----QVCEBRHuj--OLINX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0395 is similar to CPn0394, a predicted CBS domain protein (hemolysin homolog): residues 13-402 are 19% similar to residues 10-409 of CPn0394.

Pfam Summary:  Pfam Search
Residues 7 to 187 (E-value = 4.5e-44) place CPn0395 in the DUF21 family which is described as Domain of unknown function DUF21 (PF01595)
Residues 325 to 403 (E-value = 1.3e-22) place CPn0395 in the CorC_HlyC family which is described as Transporter associated domain (PF03471)

PDB Hit:


Gene Protein Sequence:
MTNSALFWIGVNIICIVLQGFYSMMEMACVSFNRVRLQYYLTKDHKKARY
INFLIRRPYRLFGTVMLGVNIALQVGSESSRNCYRALGITPDYAPFTQIF
IVVIFAELLPLTISRKIPEKLALWGAPILYYSHYIFYPLIQLIGSLTEGL
YYLLNIRKEKLNSTLSRDEFQKALETHHEEQDFNTIATNIFSLSATCADQ
VCQPLEQVTMLPSSANVKDFCRTIKNTDINFIPVYHKARKNVIGIAHPKD
FVNKALDEPLINNLHSPWFITAKSKLIRILKEFRDNRSSVAVVLNASGEP
IGILSLNAIFKILFNTTNIAHLKPKTISVIERTFPGNSRIKDLQKELDIQ
FPQYPVETLAQLVLQLLDSPAEVGTSVIINNLLLEVKEMSLSGIKTVSIK
NLLS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAATTCTGCTCTCTTTTGGATAGGAGTCAACATTATCTGTATTGT
CTTACAAGGATTCTATTCGATGATGGAAATGGCCTGCGTGTCATTTAACC
GTGTACGATTGCAATACTATCTGACTAAAGATCATAAGAAAGCTCGCTAC
ATTAATTTCCTGATTCGCCGCCCCTATCGTTTATTTGGAACGGTGATGTT
AGGAGTGAATATCGCTCTACAAGTCGGGTCTGAGTCCTCAAGAAATTGCT
ATCGAGCTTTAGGAATCACTCCAGATTACGCTCCTTTCACTCAAATTTTT
ATAGTTGTGATTTTTGCAGAACTTCTACCTCTAACAATATCACGGAAGAT
TCCTGAAAAATTAGCACTTTGGGGAGCACCGATTCTCTATTATTCCCACT
ATATTTTCTATCCTCTGATTCAGCTCATAGGAAGTCTCACTGAGGGTCTT
TACTATCTTCTAAATATTAGGAAAGAAAAATTGAACTCTACATTAAGTAG
AGACGAGTTCCAAAAAGCTTTAGAGACTCACCATGAAGAACAAGATTTCA
ATACAATTGCTACAAATATTTTCTCTTTAAGTGCGACTTGTGCAGATCAG
GTATGCCAACCTTTAGAACAGGTTACCATGCTTCCTTCTTCTGCAAATGT
TAAAGATTTTTGCCGGACTATAAAAAATACAGATATCAACTTTATTCCTG
TCTATCACAAGGCCCGAAAAAACGTTATTGGGATTGCCCATCCTAAAGAC
TTTGTCAATAAAGCTCTTGATGAACCCCTAATCAATAATCTACACTCGCC
TTGGTTTATCACTGCAAAATCAAAACTTATTCGTATCCTCAAAGAGTTTC
GAGACAACCGTTCGAGTGTTGCTGTTGTCCTCAATGCTTCTGGTGAACCT
ATAGGTATTCTTAGTTTAAATGCAATTTTCAAAATCTTATTCAACACTAC
AAACATTGCTCATTTAAAACCCAAGACCATCTCTGTTATTGAAAGAACGT
TTCCTGGCAACTCTCGCATAAAAGATCTGCAAAAAGAACTCGATATTCAA
TTTCCGCAATATCCTGTAGAAACCCTAGCCCAATTGGTATTGCAACTGCT
AGACAGTCCTGCAGAAGTAGGAACTTCTGTAATTATCAACAACTTGCTTT
TAGAAGTTAAAGAGATGTCTTTATCTGGGATAAAAACCGTATCGATTAAA
AACTTACTCTCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy